BLASTX nr result
ID: Glycyrrhiza35_contig00031940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031940 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU37566.1 hypothetical protein TSUD_153990 [Trifolium subterran... 45 7e-07 GAU38731.1 hypothetical protein TSUD_208420 [Trifolium subterran... 45 2e-06 GAU50545.1 hypothetical protein TSUD_409890 [Trifolium subterran... 39 3e-06 ABD32189.2 Polynucleotidyl transferase, Ribonuclease H fold [Med... 44 5e-06 ABN06084.1 Polynucleotidyl transferase, Ribonuclease H fold [Med... 44 5e-06 XP_012067550.1 PREDICTED: uncharacterized protein LOC105630354 [... 52 5e-06 XP_012079594.1 PREDICTED: uncharacterized protein LOC105640000 [... 52 5e-06 GAU38127.1 hypothetical protein TSUD_318140 [Trifolium subterran... 41 9e-06 >GAU37566.1 hypothetical protein TSUD_153990 [Trifolium subterraneum] Length = 343 Score = 45.1 bits (105), Expect(2) = 7e-07 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = +2 Query: 65 NHQWSILWNLDIPPKVKDFMWRACTKSLP 151 N W+++WN+ +PPKVK+ +WR C + LP Sbjct: 136 NGNWNLVWNIKVPPKVKNLIWRICRRCLP 164 Score = 35.4 bits (80), Expect(2) = 7e-07 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWH 240 R RLRDKGV+C C +C+ E+E H Sbjct: 166 RVRLRDKGVECTQTCALCNEENEDSEH 192 >GAU38731.1 hypothetical protein TSUD_208420 [Trifolium subterraneum] Length = 645 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%) Frame = +2 Query: 41 CCNKLPARNH-----QWSILWNLDIPPKVKDFMWRACTKSLP 151 C + +P R+ +W ++W +PPK+K+FMWR C LP Sbjct: 354 CISTIPGRDQHRVEGKWHLIWQTQMPPKIKNFMWRICRNCLP 395 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWH 240 R RL D+GV CP+ C++CD E H Sbjct: 397 RARLHDRGVTCPINCVLCDAGDEDSNH 423 >GAU50545.1 hypothetical protein TSUD_409890 [Trifolium subterraneum] Length = 607 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWHAL 246 RTRLR++ V+CP+ C +C E ES WH L Sbjct: 311 RTRLRERFVNCPLECPMCGNETESDWHFL 339 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 44 CNKLPARNHQWSILWNLDIPPKVKDFMWRACTKSLP 151 C P N + LW + PPK K +WR C + LP Sbjct: 274 CAVTPCENEELKWLWKIQAPPKAKHLLWRICKECLP 309 >ABD32189.2 Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 612 Score = 43.5 bits (101), Expect(2) = 5e-06 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 74 WSILWNLDIPPKVKDFMWRACTKSLP 151 WS +W L +PPK+K+FMWR C LP Sbjct: 261 WSDIWRLKVPPKIKNFMWRVCRGVLP 286 Score = 33.9 bits (76), Expect(2) = 5e-06 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWH 240 R +LRDKGV CP C+ C E + H Sbjct: 288 RNKLRDKGVQCPEACVNCSTTSEDVKH 314 >ABN06084.1 Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 519 Score = 43.5 bits (101), Expect(2) = 5e-06 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +2 Query: 74 WSILWNLDIPPKVKDFMWRACTKSLP 151 WS +W L +PPK+K+FMWR C LP Sbjct: 168 WSDIWRLKVPPKIKNFMWRVCRGVLP 193 Score = 33.9 bits (76), Expect(2) = 5e-06 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWH 240 R +LRDKGV CP C+ C E + H Sbjct: 195 RNKLRDKGVQCPEACVNCSTTSEDVKH 221 >XP_012067550.1 PREDICTED: uncharacterized protein LOC105630354 [Jatropha curcas] Length = 1197 Score = 52.4 bits (124), Expect = 5e-06 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 47 NKLPARNHQWSILWNLDIPPKVKDFMWRACTKSLP 151 ++LP+ + W+ +WNL +PPK++DFMWRAC LP Sbjct: 874 HQLPSNDSVWNRIWNLHVPPKIRDFMWRACRNILP 908 >XP_012079594.1 PREDICTED: uncharacterized protein LOC105640000 [Jatropha curcas] Length = 1244 Score = 52.4 bits (124), Expect = 5e-06 Identities = 18/35 (51%), Positives = 27/35 (77%) Frame = +2 Query: 47 NKLPARNHQWSILWNLDIPPKVKDFMWRACTKSLP 151 ++LP+ + W+ +WNL +PPK++DFMWRAC LP Sbjct: 921 HQLPSNDSVWNRIWNLHVPPKIRDFMWRACRNILP 955 >GAU38127.1 hypothetical protein TSUD_318140 [Trifolium subterraneum] Length = 359 Score = 40.8 bits (94), Expect(2) = 9e-06 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 74 WSILWNLDIPPKVKDFMWRACTKSLP 151 W+++W + PPK+K+F+WR C +P Sbjct: 142 WNLIWQIQAPPKIKNFIWRLCRNCIP 167 Score = 35.8 bits (81), Expect(2) = 9e-06 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 160 RTRLRDKGVDCPVLCMVCDREHESIWH 240 RTRL KGV+CP C++CD E E H Sbjct: 169 RTRLLQKGVNCPCNCVLCDDETEDSLH 195