BLASTX nr result
ID: Glycyrrhiza35_contig00031888
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031888 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19192.1 hypothetical protein TSUD_198740 [Trifolium subterran... 79 2e-16 YP_009232109.1 ribosomal protein L2 (chloroplast) [Lavandula ang... 70 3e-12 >GAU19192.1 hypothetical protein TSUD_198740 [Trifolium subterraneum] Length = 210 Score = 79.0 bits (193), Expect = 2e-16 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 118 RGRAGSEGSFSRQQAPLFEASPHQRKPLHASLLYRVPC 5 RGRAGSEGSFSRQQAPLFEASPHQRKPLHASLLYRV C Sbjct: 107 RGRAGSEGSFSRQQAPLFEASPHQRKPLHASLLYRVAC 144 >YP_009232109.1 ribosomal protein L2 (chloroplast) [Lavandula angustifolia] AMA20327.1 ribosomal protein L2 (chloroplast) [Lavandula angustifolia] Length = 567 Score = 69.7 bits (169), Expect = 3e-12 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 3/48 (6%) Frame = -1 Query: 208 FLEL---GEAKLQTKRLGCSLH*FDFT*LKIKDRGRAGSEGSFSRQQA 74 FL+L G+A +TKRLGCSLH FDFT LKIKDRGRAGSEGSFSRQ+A Sbjct: 378 FLKLKLPGKASNKTKRLGCSLHCFDFTLLKIKDRGRAGSEGSFSRQRA 425