BLASTX nr result
ID: Glycyrrhiza35_contig00031751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031751 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007161981.1 hypothetical protein PHAVU_001G114000g [Phaseolus... 61 3e-10 KHN46750.1 hypothetical protein glysoja_015001 [Glycine soja] KR... 60 6e-10 XP_017418159.1 PREDICTED: uncharacterized protein LOC108328783 [... 60 1e-09 ACU23937.1 unknown [Glycine max] 58 5e-09 XP_003624681.1 hypothetical protein MTR_7g086320 [Medicago trunc... 58 5e-09 GAU23980.1 hypothetical protein TSUD_327810 [Trifolium subterran... 57 7e-09 KYP72712.1 hypothetical protein KK1_005312 [Cajanus cajan] 53 4e-07 OIV94263.1 hypothetical protein TanjilG_00012 [Lupinus angustifo... 52 1e-06 >XP_007161981.1 hypothetical protein PHAVU_001G114000g [Phaseolus vulgaris] ESW33975.1 hypothetical protein PHAVU_001G114000g [Phaseolus vulgaris] Length = 77 Score = 61.2 bits (147), Expect = 3e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCAA 332 MASL+LLFSELV+N+EWDA ALLAAYPP +F T +SSCAA Sbjct: 1 MASLVLLFSELVRNHEWDAAALLAAYPPPNF--TITSSSCAA 40 >KHN46750.1 hypothetical protein glysoja_015001 [Glycine soja] KRH06664.1 hypothetical protein GLYMA_16G038100 [Glycine max] Length = 79 Score = 60.5 bits (145), Expect = 6e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCA 329 MASL+LLFSELV N+EWDAEALLAAYP S+F T +SSCA Sbjct: 1 MASLVLLFSELVHNHEWDAEALLAAYPSSNF--TITSSSCA 39 >XP_017418159.1 PREDICTED: uncharacterized protein LOC108328783 [Vigna angularis] KOM38573.1 hypothetical protein LR48_Vigan03g195500 [Vigna angularis] BAT84958.1 hypothetical protein VIGAN_04244400 [Vigna angularis var. angularis] Length = 80 Score = 59.7 bits (143), Expect = 1e-09 Identities = 30/43 (69%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSF--RSTTITSSCA 329 MASL+LLFSELV+N+EWDA ALLAAYPP +F S++ +SSCA Sbjct: 1 MASLVLLFSELVRNHEWDAAALLAAYPPPNFTITSSSSSSSCA 43 >ACU23937.1 unknown [Glycine max] Length = 79 Score = 58.2 bits (139), Expect = 5e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCA 329 MASL+LLFSE V N+EWDAEALLAAYP SF T +SSCA Sbjct: 1 MASLVLLFSEFVHNHEWDAEALLAAYP--SFNFTITSSSCA 39 >XP_003624681.1 hypothetical protein MTR_7g086320 [Medicago truncatula] AES80899.1 hypothetical protein MTR_7g086320 [Medicago truncatula] Length = 68 Score = 57.8 bits (138), Expect = 5e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCAA 332 MASLILLFSELV+N+EW+A ALLAAYPPSS TSSCA+ Sbjct: 1 MASLILLFSELVRNHEWNATALLAAYPPSS-----STSSCAS 37 >GAU23980.1 hypothetical protein TSUD_327810 [Trifolium subterraneum] Length = 67 Score = 57.4 bits (137), Expect = 7e-09 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCAA 332 MASLILLFSELV N EWDA ALLAAYPPS S+T +SS AA Sbjct: 1 MASLILLFSELVWNQEWDANALLAAYPPS---SSTSSSSVAA 39 >KYP72712.1 hypothetical protein KK1_005312 [Cajanus cajan] Length = 76 Score = 53.1 bits (126), Expect = 4e-07 Identities = 28/42 (66%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 207 MASLILLFSELVQNNE-WDAEALLAAYPPSSFRSTTITSSCA 329 MASL+LLFSELV+N++ WDA ALL+AYP S+F T+T+SCA Sbjct: 1 MASLVLLFSELVRNHDQWDAAALLSAYPSSNF---TLTTSCA 39 >OIV94263.1 hypothetical protein TanjilG_00012 [Lupinus angustifolius] Length = 84 Score = 52.0 bits (123), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 207 MASLILLFSELVQNNEWDAEALLAAYPPSSFRSTTITSSCA 329 MASL+LLFSELV+N + A ALLAAYPPSS ST +SS A Sbjct: 1 MASLVLLFSELVRNRKCGASALLAAYPPSSSYSTITSSSYA 41