BLASTX nr result
ID: Glycyrrhiza35_contig00031563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031563 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024584066.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 56 2e-07 WP_024584065.1 MULTISPECIES: amino acid ABC transporter [Bradyrh... 52 1e-05 >WP_024584066.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] OCX30837.1 hypothetical protein QU42_11815 [Bradyrhizobium sp. UASWS1016] Length = 222 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 262 RQRFEHFKHEMISRSASLLQARRDGND 182 RQRFEHFKHEMISRSASLLQARRD ND Sbjct: 195 RQRFEHFKHEMISRSASLLQARRDSND 221 >WP_024584065.1 MULTISPECIES: amino acid ABC transporter [Bradyrhizobium] KIU48353.1 amino acid ABC transporter [Bradyrhizobium elkanii] OCX30838.1 amino acid ABC transporter [Bradyrhizobium sp. UASWS1016] Length = 262 Score = 51.6 bits (122), Expect = 1e-05 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = -1 Query: 139 MENTRMXXXXXXXXXXXXXXXXXAQQAPSRLDEIVKRGTLRVGMTG 2 MENTRM AQQAPSRLDEIVKRGTLRVGMTG Sbjct: 1 MENTRMLRALAGLALAFLLSAAHAQQAPSRLDEIVKRGTLRVGMTG 46