BLASTX nr result
ID: Glycyrrhiza35_contig00031486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031486 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_061979378.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 111 3e-29 >WP_061979378.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 95 Score = 111 bits (277), Expect = 3e-29 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 169 VAALLRAPGLILARNGNVLSCREVTKDIAKIAIDDPPAFFLRFSQVLLFLVFCAGN 2 +AALLRAPGLILARNGNVLSCREVTKDIAKIAIDDPPAFFLRFSQVLLFLVFCAGN Sbjct: 1 MAALLRAPGLILARNGNVLSCREVTKDIAKIAIDDPPAFFLRFSQVLLFLVFCAGN 56