BLASTX nr result
ID: Glycyrrhiza35_contig00031440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031440 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004496178.2 PREDICTED: transcriptional activator DEMETER-like... 60 1e-07 XP_014628162.1 PREDICTED: protein ROS1-like isoform X3 [Glycine ... 58 6e-07 XP_014628159.1 PREDICTED: protein ROS1-like isoform X1 [Glycine ... 58 6e-07 KRG92053.1 hypothetical protein GLYMA_20G188300 [Glycine max] 58 6e-07 KHN00920.1 Transcriptional activator DEMETER [Glycine soja] 57 1e-06 XP_016175251.1 PREDICTED: transcriptional activator DEMETER-like... 57 1e-06 XP_014618784.1 PREDICTED: transcriptional activator DEMETER-like... 57 2e-06 KDO39948.1 hypothetical protein CISIN_1g002245mg [Citrus sinensis] 56 3e-06 AGU16984.1 DEMETER [Citrus sinensis] 56 3e-06 XP_006492175.1 PREDICTED: transcriptional activator DEMETER isof... 56 3e-06 XP_006492173.1 PREDICTED: transcriptional activator DEMETER isof... 56 3e-06 XP_006436684.1 hypothetical protein CICLE_v10030474mg [Citrus cl... 56 3e-06 KRH34732.1 hypothetical protein GLYMA_10G202200 [Glycine max] 56 4e-06 CBI40219.3 unnamed protein product, partial [Vitis vinifera] 56 4e-06 XP_015941185.1 PREDICTED: transcriptional activator DEMETER-like... 56 4e-06 KHN37846.1 Transcriptional activator DEMETER [Glycine soja] 56 4e-06 XP_015581916.1 PREDICTED: transcriptional activator DEMETER isof... 56 4e-06 XP_015581912.1 PREDICTED: transcriptional activator DEMETER isof... 56 4e-06 XP_002267310.1 PREDICTED: transcriptional activator DEMETER [Vit... 56 4e-06 KYP73792.1 Protein ROS1 [Cajanus cajan] 55 5e-06 >XP_004496178.2 PREDICTED: transcriptional activator DEMETER-like [Cicer arietinum] Length = 1828 Score = 60.1 bits (144), Expect = 1e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 F GFVCVRGFDQQ+RAPRPL RLH TESKLAK K Sbjct: 1792 FWRGFVCVRGFDQQKRAPRPLFARLHFTESKLAKTK 1827 >XP_014628162.1 PREDICTED: protein ROS1-like isoform X3 [Glycine max] Length = 1819 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 F GFVCVRGFDQ+ERAPRPLQ RLH + S+LAKA+ Sbjct: 1783 FWRGFVCVRGFDQKERAPRPLQARLHFSASRLAKAE 1818 >XP_014628159.1 PREDICTED: protein ROS1-like isoform X1 [Glycine max] XP_014628160.1 PREDICTED: protein ROS1-like isoform X2 [Glycine max] Length = 1826 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 F GFVCVRGFDQ+ERAPRPLQ RLH + S+LAKA+ Sbjct: 1790 FWRGFVCVRGFDQKERAPRPLQARLHFSASRLAKAE 1825 >KRG92053.1 hypothetical protein GLYMA_20G188300 [Glycine max] Length = 1850 Score = 58.2 bits (139), Expect = 6e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 F GFVCVRGFDQ+ERAPRPLQ RLH + S+LAKA+ Sbjct: 1814 FWRGFVCVRGFDQKERAPRPLQARLHFSASRLAKAE 1849 >KHN00920.1 Transcriptional activator DEMETER [Glycine soja] Length = 1813 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 69 GFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 GFVCVRGFDQ+ERAPRPLQ RLH + S+LAKA+ Sbjct: 1780 GFVCVRGFDQKERAPRPLQARLHFSASRLAKAE 1812 >XP_016175251.1 PREDICTED: transcriptional activator DEMETER-like [Arachis ipaensis] Length = 1795 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKNT 173 F GFVCVRGFDQQ RAPRPL+ RLH S+L KAK T Sbjct: 1756 FWRGFVCVRGFDQQTRAPRPLRARLHFPASRLTKAKKT 1793 >XP_014618784.1 PREDICTED: transcriptional activator DEMETER-like isoform X2 [Glycine max] Length = 1144 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 F GFVCVRGFDQ+ERAPRPLQ RLH + S+LAK + Sbjct: 1108 FWRGFVCVRGFDQKERAPRPLQARLHFSASRLAKTE 1143 >KDO39948.1 hypothetical protein CISIN_1g002245mg [Citrus sinensis] Length = 947 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH SKL KA+N Sbjct: 907 FWKGFVCVRGFDQKSRAPRPLMARLHFPASKLVKARN 943 >AGU16984.1 DEMETER [Citrus sinensis] Length = 1573 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH SKL KA+N Sbjct: 1533 FWKGFVCVRGFDQKSRAPRPLMARLHFPASKLVKARN 1569 >XP_006492175.1 PREDICTED: transcriptional activator DEMETER isoform X2 [Citrus sinensis] Length = 1958 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH SKL KA+N Sbjct: 1918 FWKGFVCVRGFDQKSRAPRPLMARLHFPASKLVKARN 1954 >XP_006492173.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Citrus sinensis] XP_006492174.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Citrus sinensis] Length = 2029 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH SKL KA+N Sbjct: 1989 FWKGFVCVRGFDQKSRAPRPLMARLHFPASKLVKARN 2025 >XP_006436684.1 hypothetical protein CICLE_v10030474mg [Citrus clementina] ESR49924.1 hypothetical protein CICLE_v10030474mg [Citrus clementina] Length = 2029 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH SKL KA+N Sbjct: 1989 FWKGFVCVRGFDQKSRAPRPLMARLHFPASKLVKARN 2025 >KRH34732.1 hypothetical protein GLYMA_10G202200 [Glycine max] Length = 1429 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 69 GFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 GFVCVRGFDQ+ERAPRPLQ RLH + S+LAK + Sbjct: 1396 GFVCVRGFDQKERAPRPLQARLHFSASRLAKTE 1428 >CBI40219.3 unnamed protein product, partial [Vitis vinifera] Length = 1621 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH + +KL+K KN Sbjct: 1582 FWRGFVCVRGFDQKSRAPRPLMARLHLSANKLSKTKN 1618 >XP_015941185.1 PREDICTED: transcriptional activator DEMETER-like [Arachis duranensis] Length = 1804 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKNT 173 F GFVCVRGFDQQ RAPRPL+ RLH S+L KAK T Sbjct: 1765 FWRGFVCVRGFDQQTRAPRPLRARLHFPASRLTKAKIT 1802 >KHN37846.1 Transcriptional activator DEMETER [Glycine soja] Length = 1843 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 69 GFVCVRGFDQQERAPRPLQNRLHCTESKLAKAK 167 GFVCVRGFDQ+ERAPRPLQ RLH + S+LAK + Sbjct: 1810 GFVCVRGFDQKERAPRPLQARLHFSASRLAKTE 1842 >XP_015581916.1 PREDICTED: transcriptional activator DEMETER isoform X2 [Ricinus communis] Length = 1896 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQQ RAP+PL RLH SKLAK N Sbjct: 1857 FWKGFVCVRGFDQQSRAPKPLMARLHFPASKLAKTNN 1893 >XP_015581912.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Ricinus communis] XP_015581913.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Ricinus communis] XP_015581914.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Ricinus communis] XP_015581915.1 PREDICTED: transcriptional activator DEMETER isoform X1 [Ricinus communis] Length = 1897 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQQ RAP+PL RLH SKLAK N Sbjct: 1858 FWKGFVCVRGFDQQSRAPKPLMARLHFPASKLAKTNN 1894 >XP_002267310.1 PREDICTED: transcriptional activator DEMETER [Vitis vinifera] XP_010658708.1 PREDICTED: transcriptional activator DEMETER [Vitis vinifera] Length = 2198 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKN 170 F GFVCVRGFDQ+ RAPRPL RLH + +KL+K KN Sbjct: 2159 FWRGFVCVRGFDQKSRAPRPLMARLHLSANKLSKTKN 2195 >KYP73792.1 Protein ROS1 [Cajanus cajan] Length = 1650 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/65 (49%), Positives = 38/65 (58%) Frame = +3 Query: 60 FISGFVCVRGFDQQERAPRPLQNRLHCTESKLAKAKNT*IIGHVAKKFTSKS*Y*RSKSN 239 F G+VCVRGFD++ RAPRPL RLH SKLAK K KK +S + SKSN Sbjct: 1578 FWRGYVCVRGFDRETRAPRPLMARLHFPASKLAKTKEK------TKKESSSAKSRGSKSN 1631 Query: 240 CPRPD 254 P+ Sbjct: 1632 IEHPE 1636