BLASTX nr result
ID: Glycyrrhiza35_contig00031364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031364 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004490692.1 PREDICTED: uncharacterized protein LOC101510207 [... 88 2e-19 XP_004490670.1 PREDICTED: uncharacterized protein LOC101500706 i... 88 1e-18 XP_004490669.1 PREDICTED: uncharacterized protein LOC101500706 i... 88 1e-18 XP_004490668.1 PREDICTED: uncharacterized protein LOC101500706 i... 88 1e-18 XP_003615884.1 exocyst subunit exo70 family protein [Medicago tr... 87 4e-18 XP_003615919.1 exocyst subunit exo70 family protein [Medicago tr... 86 7e-18 XP_003615953.1 transmembrane protein, putative [Medicago truncat... 86 8e-18 XP_003615899.1 transmembrane protein, putative [Medicago truncat... 83 3e-17 XP_013460248.1 exocyst subunit exo70 family protein [Medicago tr... 84 4e-17 XP_003615916.1 exocyst subunit exo70 family protein [Medicago tr... 84 5e-17 XP_003615907.1 exocyst subunit exo70 family protein [Medicago tr... 83 9e-17 XP_003615934.1 exocyst subunit exo70 family protein [Medicago tr... 83 1e-16 XP_003615886.1 exocyst subunit exo70 family protein [Medicago tr... 82 2e-16 XP_003615885.1 transmembrane protein, putative [Medicago truncat... 80 3e-16 XP_012568456.1 PREDICTED: exocyst complex component EXO70B1-like... 81 5e-16 KHN19141.1 hypothetical protein glysoja_045792 [Glycine soja] 78 6e-16 XP_003617614.1 exocyst subunit exo70 family protein [Medicago tr... 80 9e-16 XP_003615928.1 exocyst subunit exo70 family protein [Medicago tr... 80 9e-16 XP_003615896.2 exocyst subunit exo70 family protein [Medicago tr... 79 2e-15 XP_006596448.1 PREDICTED: exocyst complex component EXO70B1-like... 79 3e-15 >XP_004490692.1 PREDICTED: uncharacterized protein LOC101510207 [Cicer arietinum] Length = 277 Score = 88.2 bits (217), Expect = 2e-19 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MTP+LIQI WL+ P VWRF GFAS VVGLLCYALSSSFN++FGEWNLLK Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCYALSSSFNYLFGEWNLLK 50 >XP_004490670.1 PREDICTED: uncharacterized protein LOC101500706 isoform X3 [Cicer arietinum] Length = 834 Score = 88.2 bits (217), Expect = 1e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MTP+LIQI WL+ P VWRF GFAS VVGLLCYALSSSFN++FGEWNLLK Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCYALSSSFNYLFGEWNLLK 50 >XP_004490669.1 PREDICTED: uncharacterized protein LOC101500706 isoform X2 [Cicer arietinum] Length = 999 Score = 88.2 bits (217), Expect = 1e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MTP+LIQI WL+ P VWRF GFAS VVGLLCYALSSSFN++FGEWNLLK Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCYALSSSFNYLFGEWNLLK 50 >XP_004490668.1 PREDICTED: uncharacterized protein LOC101500706 isoform X1 [Cicer arietinum] Length = 1009 Score = 88.2 bits (217), Expect = 1e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MTP+LIQI WL+ P VWRF GFAS VVGLLCYALSSSFN++FGEWNLLK Sbjct: 1 MTPILIQIWRWLMHPKVWRFGGFASAVVGLLCYALSSSFNYLFGEWNLLK 50 >XP_003615884.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98842.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 697 Score = 86.7 bits (213), Expect = 4e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MT +LIQI WL+QP VWRFVGFAS VVGL+CYALSSSFN++FGEWN LK Sbjct: 1 MTNILIQIWRWLMQPKVWRFVGFASVVVGLVCYALSSSFNYLFGEWNFLK 50 >XP_003615919.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98877.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 431 Score = 85.9 bits (211), Expect = 7e-18 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M P++IQIR WL++ VWRFVGF S VGL+CYALSSSFNH+FG WNLLK Sbjct: 1 MIPLIIQIRCWLLETKVWRFVGFVSAAVGLICYALSSSFNHLFGNWNLLK 50 >XP_003615953.1 transmembrane protein, putative [Medicago truncatula] AES98911.1 transmembrane protein, putative [Medicago truncatula] Length = 530 Score = 85.9 bits (211), Expect = 8e-18 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MT +++QI W +QP VWRFVGFAS++VGLLCYALSSSFN++FG+WNLLK Sbjct: 1 MTSIVVQIWRWFLQPKVWRFVGFASSIVGLLCYALSSSFNYLFGDWNLLK 50 >XP_003615899.1 transmembrane protein, putative [Medicago truncatula] AES98857.1 transmembrane protein, putative [Medicago truncatula] Length = 297 Score = 82.8 bits (203), Expect = 3e-17 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = -1 Query: 201 LSECVSVKVIVTQFKEIMTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIF 22 LS S+K+I+T F + T R W++ P VWRFVGFAS+VVGLLCYALSSSFN++F Sbjct: 4 LSPTPSLKLIITHFTQHGTYSNPNWR-WMMLPKVWRFVGFASSVVGLLCYALSSSFNYLF 62 Query: 21 GEWNLLK 1 GEWNLLK Sbjct: 63 GEWNLLK 69 >XP_013460248.1 exocyst subunit exo70 family protein [Medicago truncatula] KEH34279.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 681 Score = 84.0 bits (206), Expect = 4e-17 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M P+LIQI WL+Q VWRFVGFAS +VGL+CYALSSSFN++FGEWNL K Sbjct: 1 MMPILIQILRWLMQEKVWRFVGFASAIVGLVCYALSSSFNYLFGEWNLSK 50 >XP_003615916.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98874.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 712 Score = 83.6 bits (205), Expect = 5e-17 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M P++I+IRM L+Q VWRFVGFAS VGLLCYALS+SFNH+FG WNLLK Sbjct: 1 MIPVIIRIRMCLLQTKVWRFVGFASAAVGLLCYALSTSFNHLFGNWNLLK 50 >XP_003615907.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98865.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 473 Score = 82.8 bits (203), Expect = 9e-17 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = -1 Query: 201 LSECVSVKVIVTQFKEIMTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIF 22 LS S+K+I+T F + T R W++ P VWRFVGFAS+VVGLLCYALSSSFN++F Sbjct: 4 LSPTPSLKLIITHFTQHGTYSNPNWR-WMMLPKVWRFVGFASSVVGLLCYALSSSFNYLF 62 Query: 21 GEWNLLK 1 GEWNLLK Sbjct: 63 GEWNLLK 69 >XP_003615934.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98892.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 502 Score = 82.8 bits (203), Expect = 1e-16 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 141 MLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M+I+IRMWL++ VWRFV F S V+GLLCYALSSSFNH+FG WNLLK Sbjct: 1 MIIRIRMWLLKAKVWRFVSFVSAVIGLLCYALSSSFNHLFGNWNLLK 47 >XP_003615886.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98844.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 625 Score = 82.0 bits (201), Expect = 2e-16 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M +LIQ W++QP VWRFVGFAS+ +GLLCYALSSSFN++FG+WNLLK Sbjct: 1 MAHILIQTWRWMMQPKVWRFVGFASSAIGLLCYALSSSFNYLFGDWNLLK 50 >XP_003615885.1 transmembrane protein, putative [Medicago truncatula] AES98843.1 transmembrane protein, putative [Medicago truncatula] Length = 274 Score = 80.1 bits (196), Expect = 3e-16 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MT +LIQI WL+ P V RFVGFAS V+GLLCYALSSSFN++FG+WNLLK Sbjct: 1 MTRILIQIWRWLMHPKVCRFVGFASAVLGLLCYALSSSFNYLFGDWNLLK 50 >XP_012568456.1 PREDICTED: exocyst complex component EXO70B1-like [Cicer arietinum] Length = 687 Score = 80.9 bits (198), Expect = 5e-16 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -1 Query: 141 MLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 +LIQIR WL+Q VW+++GF S VVGL+CYALSSSFNH+FG WNLLK Sbjct: 3 ILIQIRSWLMQTTVWKYLGFTSAVVGLVCYALSSSFNHLFGNWNLLK 49 >KHN19141.1 hypothetical protein glysoja_045792 [Glycine soja] Length = 200 Score = 77.8 bits (190), Expect = 6e-16 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MT + IQ+ WL + AVWR+VGF ST+VGLLCY LSSSFN +FGEW+LLK Sbjct: 1 MTSLTIQMARWLKKEAVWRYVGFVSTIVGLLCYGLSSSFNSLFGEWSLLK 50 >XP_003617614.1 exocyst subunit exo70 family protein [Medicago truncatula] AET00573.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 575 Score = 80.1 bits (196), Expect = 9e-16 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = -1 Query: 141 MLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MLI+++ WL+Q VWRFVGFAS VGL+CYALSSSFN++FG WNLLK Sbjct: 5 MLIKVQRWLLQTKVWRFVGFASAAVGLVCYALSSSFNYLFGNWNLLK 51 >XP_003615928.1 exocyst subunit exo70 family protein [Medicago truncatula] AES98886.1 exocyst subunit exo70 family protein [Medicago truncatula] Length = 750 Score = 80.1 bits (196), Expect = 9e-16 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 141 MLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M+I+I+ WL+Q VWRFVGFAS VGLLCYALSSSFN++FG WNLLK Sbjct: 5 MVIKIQRWLMQTKVWRFVGFASAAVGLLCYALSSSFNYLFGNWNLLK 51 >XP_003615896.2 exocyst subunit exo70 family protein [Medicago truncatula] AES98854.2 exocyst subunit exo70 family protein [Medicago truncatula] Length = 1073 Score = 79.3 bits (194), Expect = 2e-15 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 M LIQ W++ P VWRFVGFAS++VGL+CYALSSSFN++FGEWNLLK Sbjct: 1 MVHTLIQTWRWMMLPKVWRFVGFASSLVGLVCYALSSSFNYLFGEWNLLK 50 >XP_006596448.1 PREDICTED: exocyst complex component EXO70B1-like [Glycine max] KRH17119.1 hypothetical protein GLYMA_14G199600 [Glycine max] Length = 714 Score = 78.6 bits (192), Expect = 3e-15 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -1 Query: 150 MTPMLIQIRMWLIQPAVWRFVGFASTVVGLLCYALSSSFNHIFGEWNLLK 1 MT + I++ WL Q AVWRFVGF ST+VGL+CY LSSSFN++FGEW+LLK Sbjct: 1 MTLLAIKMTRWLTQVAVWRFVGFVSTIVGLVCYGLSSSFNYLFGEWSLLK 50