BLASTX nr result
ID: Glycyrrhiza35_contig00031255
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031255 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008245527.1 PREDICTED: transcription repressor OFP6-like [Pru... 61 2e-09 XP_007207871.1 hypothetical protein PRUPE_ppa022029mg [Prunus pe... 59 1e-08 XP_006594926.1 PREDICTED: transcription repressor OFP10-like [Gl... 58 3e-08 XP_009374782.1 PREDICTED: transcription repressor OFP4-like [Pyr... 57 9e-08 ONI01438.1 hypothetical protein PRUPE_6G139400, partial [Prunus ... 56 2e-07 XP_011459413.1 PREDICTED: transcription repressor OFP6 [Fragaria... 56 2e-07 KRH26670.1 hypothetical protein GLYMA_12G187500 [Glycine max] 55 2e-07 XP_007015720.2 PREDICTED: transcription repressor OFP6 [Theobrom... 55 4e-07 EOY33339.1 Ovate family protein 6, putative [Theobroma cacao] 55 4e-07 XP_009369931.2 PREDICTED: transcription repressor OFP3 [Pyrus x ... 55 6e-07 XP_016169548.1 PREDICTED: transcription repressor OFP3 [Arachis ... 53 2e-06 XP_015936034.1 PREDICTED: transcription repressor OFP8 [Arachis ... 53 2e-06 XP_010102030.1 hypothetical protein L484_016321 [Morus notabilis... 53 2e-06 OMO96300.1 hypothetical protein CCACVL1_05009 [Corchorus capsula... 53 3e-06 XP_008361544.2 PREDICTED: transcription repressor OFP6-like [Mal... 52 4e-06 GAV77464.1 Ovate domain-containing protein [Cephalotus follicula... 51 8e-06 >XP_008245527.1 PREDICTED: transcription repressor OFP6-like [Prunus mume] Length = 187 Score = 60.8 bits (146), Expect = 2e-09 Identities = 33/79 (41%), Positives = 42/79 (53%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQLHXXXXXXXXXXX 218 MS +K+ +L++TLL +NI GCGC KPK SDVY+PTP PK N L Sbjct: 1 MSSSKKHKLIKTLLISNIAGCGCGKPKLSDVYEPTPKPKTQIPQNPTLKRRSSSSSCDKN 60 Query: 219 XXXXXXXRDRNEDEDFTTT 275 D NED+ +TT Sbjct: 61 GSFTVDDDDDNEDQCTSTT 79 >XP_007207871.1 hypothetical protein PRUPE_ppa022029mg [Prunus persica] Length = 188 Score = 58.9 bits (141), Expect = 1e-08 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPK 155 MS +K+ +L++TLL +NI GCGC KPK SDVY+PTP PK Sbjct: 1 MSSSKKHKLIKTLLISNIAGCGCGKPKLSDVYEPTPKPK 39 >XP_006594926.1 PREDICTED: transcription repressor OFP10-like [Glycine max] KRH22646.1 hypothetical protein GLYMA_13G314000 [Glycine max] Length = 184 Score = 57.8 bits (138), Expect = 3e-08 Identities = 38/81 (46%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQLHXXXXXXXXXXX 218 MS NKR R MR L N GGCGCSKPK SDV++PTP PKIS N + Sbjct: 1 MSSNKR-RFMRALFKAN-GGCGCSKPKSSDVHEPTPKPKISIYQNTKTSSLNSSTTSG-- 56 Query: 219 XXXXXXXRDRNEDED-FTTTS 278 DRNED++ FT+T+ Sbjct: 57 --------DRNEDDEVFTSTT 69 >XP_009374782.1 PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri] XP_009347154.1 PREDICTED: transcription repressor OFP4-like [Pyrus x bretschneideri] Length = 191 Score = 56.6 bits (135), Expect = 9e-08 Identities = 29/80 (36%), Positives = 42/80 (52%) Frame = +3 Query: 36 LMSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQLHXXXXXXXXXX 215 + S +K+ +L+ T+LT N+ CGC +PK SDV++PTP PKI + N +H Sbjct: 1 MSSSSKKKKLLTTILTANVAACGCGRPKLSDVHEPTPKPKIQTHKN-PIHRSLSSSSSGD 59 Query: 216 XXXXXXXXRDRNEDEDFTTT 275 D NED +TT Sbjct: 60 QNGKSFTVEDDNEDRCTSTT 79 >ONI01438.1 hypothetical protein PRUPE_6G139400, partial [Prunus persica] Length = 184 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +3 Query: 51 KRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPK 155 K+ +L++TLL +NI GCGC KPK SDVY+PTP PK Sbjct: 1 KKHKLIKTLLISNIAGCGCGKPKLSDVYEPTPKPK 35 >XP_011459413.1 PREDICTED: transcription repressor OFP6 [Fragaria vesca subsp. vesca] Length = 211 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/40 (57%), Positives = 32/40 (80%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKI 158 MS K+++ ++TL+T+NI GCGC +PK SDVY+PT PKI Sbjct: 1 MSSTKKTKFLKTLVTSNIRGCGCGRPKLSDVYEPTAKPKI 40 >KRH26670.1 hypothetical protein GLYMA_12G187500 [Glycine max] Length = 186 Score = 55.5 bits (132), Expect = 2e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKIS 161 MS NKR R MR L N GGCGCSKPK SDV++PTP PKIS Sbjct: 1 MSSNKR-RFMRALYKAN-GGCGCSKPKSSDVHEPTPKPKIS 39 >XP_007015720.2 PREDICTED: transcription repressor OFP6 [Theobroma cacao] Length = 195 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQL 182 MS +K++ L++TLLT N G CGC +PK SDVY+P P KIS+I N +L Sbjct: 1 MSSSKKN-LLKTLLTANAGSCGCGRPKLSDVYEPKPKSKISAIQNPKL 47 >EOY33339.1 Ovate family protein 6, putative [Theobroma cacao] Length = 195 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQL 182 MS +K++ L++TLLT N G CGC +PK SDVY+P P KIS+I N +L Sbjct: 1 MSSSKKN-LLKTLLTANAGSCGCGRPKLSDVYEPKPKSKISAIQNPKL 47 >XP_009369931.2 PREDICTED: transcription repressor OFP3 [Pyrus x bretschneideri] Length = 240 Score = 55.1 bits (131), Expect = 6e-07 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = +3 Query: 27 HMLLMSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKI 158 ++ LMS + +++L+ T+LT NI GC C +PK S+VY+PTP PKI Sbjct: 50 YISLMSSSSKNKLLATILTANIPGCDCGRPKLSNVYEPTPKPKI 93 >XP_016169548.1 PREDICTED: transcription repressor OFP3 [Arachis ipaensis] Length = 183 Score = 53.1 bits (126), Expect = 2e-06 Identities = 33/80 (41%), Positives = 43/80 (53%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQLHXXXXXXXXXXX 218 MS NK+ +MRT+L ++ GGCGC K KPS+V+ P P PKIS YQ Sbjct: 1 MSSNKKG-IMRTILLSSNGGCGCGKQKPSEVHQPAPKPKISV---YQ---------TTNP 47 Query: 219 XXXXXXXRDRNEDEDFTTTS 278 D +DEDFT+T+ Sbjct: 48 STSSTTSGDPADDEDFTSTT 67 >XP_015936034.1 PREDICTED: transcription repressor OFP8 [Arachis duranensis] Length = 183 Score = 53.1 bits (126), Expect = 2e-06 Identities = 33/80 (41%), Positives = 43/80 (53%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISSIINYQLHXXXXXXXXXXX 218 MS NK+ +MRT+L ++ GGCGC K KPS+V+ P P PKIS YQ Sbjct: 1 MSSNKKG-IMRTILLSSNGGCGCGKQKPSEVHQPAPKPKISV---YQ---------TTNP 47 Query: 219 XXXXXXXRDRNEDEDFTTTS 278 D +DEDFT+T+ Sbjct: 48 STSSTTSGDPADDEDFTSTT 67 >XP_010102030.1 hypothetical protein L484_016321 [Morus notabilis] EXB91250.1 hypothetical protein L484_016321 [Morus notabilis] Length = 200 Score = 53.1 bits (126), Expect = 2e-06 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKIS 161 MS N+ +L++T+ N G CGC KPK SDV++PTP PK S Sbjct: 1 MSSNRSKKLLKTIFKANGGNCGCGKPKLSDVFEPTPKPKTS 41 >OMO96300.1 hypothetical protein CCACVL1_05009 [Corchorus capsularis] Length = 221 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKISS 164 MS NK++ L++TLLT N G CGC +PK SDVY+P P KIS+ Sbjct: 1 MSSNKKN-LLKTLLTGNAGSCGCGRPKLSDVYEPKPKSKISA 41 >XP_008361544.2 PREDICTED: transcription repressor OFP6-like [Malus domestica] Length = 196 Score = 52.4 bits (124), Expect = 4e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +3 Query: 60 RLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPKI 158 +L+ T+LT NI GC C +PK SDVYDPTP PKI Sbjct: 16 KLLTTILTANIPGCDCGRPKLSDVYDPTPKPKI 48 >GAV77464.1 Ovate domain-containing protein [Cephalotus follicularis] Length = 170 Score = 51.2 bits (121), Expect = 8e-06 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = +3 Query: 39 MSFNKRSRLMRTLLTTNIGGCGCSKPKPSDVYDPTPIPK 155 MS + L++T+ T N GCGCS PK SDVY+PTPIPK Sbjct: 1 MSCCNKKNLLKTIYTAN-AGCGCSTPKSSDVYEPTPIPK 38