BLASTX nr result
ID: Glycyrrhiza35_contig00031087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00031087 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU15116.1 hypothetical protein TSUD_08540 [Trifolium subterraneum] 55 2e-06 >GAU15116.1 hypothetical protein TSUD_08540 [Trifolium subterraneum] Length = 855 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/71 (43%), Positives = 33/71 (46%) Frame = +3 Query: 3 RTPPTIHLLXXXXXXXXXXXMSSRPXXXXXXXXXXXXXXXXXXDQFVTGDAHFRSVRDVN 182 RTPPTIH L MSSRP FVTGD H +SVRD N Sbjct: 3 RTPPTIHFLAATDTAFSTATMSSRPYHRGHRRGYSGRSNSGGRGHFVTGDDHLQSVRDAN 62 Query: 183 SELRRGERGSF 215 S LRRGE +F Sbjct: 63 SALRRGESENF 73