BLASTX nr result
ID: Glycyrrhiza35_contig00030391
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030391 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_041370987.1 PhoH family protein [Methylobacterium populi] OAH... 122 6e-33 OHV16061.1 phosphate starvation-inducible protein PhoH [Methylob... 121 2e-32 WP_003603768.1 MULTISPECIES: PhoH family protein [Methylobacteri... 121 2e-32 WP_060768265.1 phosphate starvation-inducible protein PhoH [Meth... 121 2e-32 WP_056500857.1 phosphate starvation-inducible protein PhoH [Meth... 121 2e-32 WP_026105273.1 PhoH family protein [Methylobacterium sp. MB200] 121 2e-32 SFL16862.1 phosphate starvation-inducible protein PhoH [Methylob... 119 9e-32 WP_056246476.1 phosphate starvation-inducible protein PhoH [Meth... 118 3e-31 WP_056202230.1 phosphate starvation-inducible protein PhoH [Meth... 117 5e-31 WP_007569167.1 PhoH family protein [Methylobacterium sp. GXF4] E... 106 2e-26 WP_012321860.1 MULTISPECIES: PhoH family protein [Bacteria] ACB2... 105 2e-26 WP_056382292.1 phosphate starvation-inducible protein PhoH [Meth... 105 2e-26 WP_056471439.1 phosphate starvation-inducible protein PhoH [Meth... 105 2e-26 WP_055945921.1 MULTISPECIES: phosphate starvation-inducible prot... 105 2e-26 WP_042673543.1 PhoH family protein [Methylobacterium sp. B34] 105 2e-26 WP_010684291.1 PhoH family protein [Methylobacterium mesophilicu... 105 2e-26 SFL31824.1 phosphate starvation-inducible protein PhoH [Methylob... 105 3e-26 WP_056087875.1 phosphate starvation-inducible protein PhoH [Meth... 105 3e-26 WP_056170413.1 MULTISPECIES: phosphate starvation-inducible prot... 105 3e-26 SDN55989.1 phosphate starvation-inducible protein PhoH [Methylob... 104 6e-26 >WP_041370987.1 PhoH family protein [Methylobacterium populi] OAH35069.1 phosphate starvation-inducible protein PhoH [Methylobacterium populi] Length = 238 Score = 122 bits (307), Expect = 6e-33 Identities = 61/62 (98%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >OHV16061.1 phosphate starvation-inducible protein PhoH [Methylobacterium extorquens] Length = 238 Score = 121 bits (304), Expect = 2e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTD+QGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_003603768.1 MULTISPECIES: PhoH family protein [Methylobacterium] ABY28747.1 PhoH family protein [Methylobacterium extorquens PA1] ACK81305.1 PhoH family protein [Methylobacterium extorquens CM4] CAX21868.1 putative phosphate starvation induced PhoH-like protein [Methylobacterium extorquens DM4] EHP90528.1 PhoH family protein [Methylobacterium extorquens DSM 13060] KQO90989.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf90] KQO91256.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf92] KQP85830.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf119] KQQ20294.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf122] APX84266.1 PhoH family protein [Methylobacterium extorquens] Length = 238 Score = 121 bits (304), Expect = 2e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTD+QGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_060768265.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. AMS5] AMB43473.1 phosphate starvation protein PhoH [Methylobacterium sp. AMS5] Length = 238 Score = 121 bits (304), Expect = 2e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTD+QGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056500857.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf121] KQQ13983.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf121] Length = 238 Score = 121 bits (304), Expect = 2e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTD+QGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_026105273.1 PhoH family protein [Methylobacterium sp. MB200] Length = 238 Score = 121 bits (303), Expect = 2e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTDKQG+YLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDKQGKYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >SFL16862.1 phosphate starvation-inducible protein PhoH [Methylobacterium salsuginis] Length = 238 Score = 119 bits (299), Expect = 9e-32 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTDKQGQYLDALA+S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDKQGQYLDALATSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056246476.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf456] KQT50109.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf456] Length = 238 Score = 118 bits (296), Expect = 3e-31 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERNPAPIQPLTD+QGQYLDALA+S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDALATSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056202230.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf123] KQQ13566.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf123] Length = 238 Score = 117 bits (294), Expect = 5e-31 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR IRMHRTRFDEERN APIQPLTD+QGQYLDALASSSQVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPIRMHRTRFDEERNLAPIQPLTDRQGQYLDALASSSQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_007569167.1 PhoH family protein [Methylobacterium sp. GXF4] EIZ81560.1 PhoH family protein [Methylobacterium sp. GXF4] SFJ72916.1 phosphate starvation-inducible protein PhoH [Methylobacterium brachiatum] Length = 238 Score = 106 bits (264), Expect = 2e-26 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRR RLELVEDR+ R+HRTRFDEERN +PIQPLTD+Q +YLDALASS QVIVLGPAGT Sbjct: 1 MKRRRTRLELVEDRTPRIHRTRFDEERNLSPIQPLTDRQAEYLDALASSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_012321860.1 MULTISPECIES: PhoH family protein [Bacteria] ACB26909.1 PhoH family protein [Methylobacterium radiotolerans JCM 2831] AIQ93393.1 Phosphate starvation-inducible protein PhoH [Methylobacterium oryzae CBMB20] KIU28341.1 phosphate starvation protein PhoH [Methylobacterium radiotolerans] GAN49476.1 PhoH family protein [Methylobacterium sp. ME121] KOX56502.1 phosphate starvation protein PhoH [Asanoa ferruginea] KOX56937.1 phosphate starvation protein PhoH [Streptomyces purpurogeneiscleroticus] KQS85258.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf361] KTS11176.1 phosphate starvation protein PhoH [Methylobacterium radiotolerans] KTS41634.1 phosphate starvation protein PhoH [Methylobacterium radiotolerans] KZC02718.1 PhoH-like protein [Methylobacterium radiotolerans] SEF44402.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. 190mf] SEH26409.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. 275MFSha3.1] SEN87237.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. UNC300MFChir4.1] SFG73269.1 phosphate starvation-inducible protein PhoH [Methylobacterium phyllosphaerae] SFD83187.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. 13MFTsu3.1M2] SFS77452.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. yr668] SFU98423.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. UNCCL125] APT33677.1 phoH-like protein [Methylobacterium phyllosphaerae] ONF47036.1 phosphate starvation protein PhoH [Methylobacterium radiotolerans] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR+ R+HRTRFDEERN APIQPLT++Q +YLDALA S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRTSRIHRTRFDEERNLAPIQPLTERQAEYLDALARSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056382292.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf465] KQT71445.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf465] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR +R+H+TRFDEERN +PIQPLTD+Q QYLDALA QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPVRLHKTRFDEERNLSPIQPLTDRQAQYLDALALHKQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056471439.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf104] KQP38233.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf104] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR +R+H+TRFDEERN +PIQPLTD+Q QYLDALA QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPVRLHKTRFDEERNLSPIQPLTDRQAQYLDALALHKQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_055945921.1 MULTISPECIES: phosphate starvation-inducible protein PhoH [Methylobacterium] KQO63291.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf88] KQO69285.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf89] KQP52402.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf111] KQQ47848.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf125] KQU34097.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf94] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR +R+H+TRFDEERN +PIQPLTD+Q QYLDALA QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRPVRLHKTRFDEERNLSPIQPLTDRQAQYLDALALHKQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_042673543.1 PhoH family protein [Methylobacterium sp. B34] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR+ R+HRTRFDEERN APIQPLT++Q +YLDALA S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRTSRIHRTRFDEERNLAPIQPLTERQAEYLDALARSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_010684291.1 PhoH family protein [Methylobacterium mesophilicum] EMS42462.1 PhoH family protein [Methylobacterium mesophilicum SR1.6/6] Length = 238 Score = 105 bits (263), Expect = 2e-26 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR+ R+HRTRFDEERN APIQPLT++Q +YLDALA S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRTSRIHRTRFDEERNLAPIQPLTERQAEYLDALARSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >SFL31824.1 phosphate starvation-inducible protein PhoH [Methylobacterium pseudosasicola] Length = 238 Score = 105 bits (262), Expect = 3e-26 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRR RLELVEDR+ R+HRTRFDEERN +PIQPLT++Q +YLDALASS+QVIVLGPAGT Sbjct: 1 MKRRRTRLELVEDRTPRIHRTRFDEERNLSPIQPLTERQAEYLDALASSAQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056087875.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf99] KQP10287.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf99] Length = 238 Score = 105 bits (262), Expect = 3e-26 Identities = 51/62 (82%), Positives = 55/62 (88%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRR RLELVEDR +R+HRTRFDEERN +PIQPLTD+Q QYLDALA QVIVLGPAGT Sbjct: 1 MKRRRTRLELVEDRPVRLHRTRFDEERNLSPIQPLTDRQAQYLDALALHKQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >WP_056170413.1 MULTISPECIES: phosphate starvation-inducible protein PhoH [Methylobacterium] KQO73031.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf87] KQP30394.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf102] KQP32324.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf100] KQP66108.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf112] KQT99152.1 phosphate starvation-inducible protein PhoH [Methylobacterium sp. Leaf469] Length = 238 Score = 105 bits (262), Expect = 3e-26 Identities = 51/62 (82%), Positives = 55/62 (88%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRR RLELVEDR +R+HRTRFDEERN +PIQPLTD+Q QYLDALA QVIVLGPAGT Sbjct: 1 MKRRRTRLELVEDRPVRLHRTRFDEERNLSPIQPLTDRQAQYLDALALHKQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62 >SDN55989.1 phosphate starvation-inducible protein PhoH [Methylobacterium phyllostachyos] Length = 238 Score = 104 bits (260), Expect = 6e-26 Identities = 51/62 (82%), Positives = 57/62 (91%) Frame = +1 Query: 82 MKRRRARLELVEDRSIRMHRTRFDEERNPAPIQPLTDKQGQYLDALASSSQVIVLGPAGT 261 MKRRRARLELVEDR+ R+HRTRFDEERN +PIQPLT++Q +YLDALA S QVIVLGPAGT Sbjct: 1 MKRRRARLELVEDRTSRIHRTRFDEERNLSPIQPLTERQAEYLDALARSPQVIVLGPAGT 60 Query: 262 GK 267 GK Sbjct: 61 GK 62