BLASTX nr result
ID: Glycyrrhiza35_contig00030297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030297 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU15849.1 unknown [Glycine max] 54 2e-07 KRH07243.1 hypothetical protein GLYMA_16G076400 [Glycine max] 54 9e-07 XP_003547734.2 PREDICTED: uncharacterized protein LOC100500694 [... 54 9e-07 >ACU15849.1 unknown [Glycine max] Length = 88 Score = 53.5 bits (127), Expect = 2e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 116 MESPPRCRXXXXXXXXXXXXXXXXXFVLCIASEIKRNKEEDLRWN 250 ME PPRC+ FVLCIA+EIKRNKEEDLRWN Sbjct: 1 MEKPPRCKFTVFFFIIISLSLGLISFVLCIAAEIKRNKEEDLRWN 45 >KRH07243.1 hypothetical protein GLYMA_16G076400 [Glycine max] Length = 183 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 116 MESPPRCRXXXXXXXXXXXXXXXXXFVLCIASEIKRNKEEDLRWN 250 ME PPRC+ FVLCIA+EIKRNKEEDLRWN Sbjct: 1 MEKPPRCKFTVFFFIIISLSLGLISFVLCIAAEIKRNKEEDLRWN 45 >XP_003547734.2 PREDICTED: uncharacterized protein LOC100500694 [Glycine max] KHN27502.1 hypothetical protein glysoja_018614 [Glycine soja] KRH07244.1 hypothetical protein GLYMA_16G076400 [Glycine max] Length = 185 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +2 Query: 116 MESPPRCRXXXXXXXXXXXXXXXXXFVLCIASEIKRNKEEDLRWN 250 ME PPRC+ FVLCIA+EIKRNKEEDLRWN Sbjct: 1 MEKPPRCKFTVFFFIIISLSLGLISFVLCIAAEIKRNKEEDLRWN 45