BLASTX nr result
ID: Glycyrrhiza35_contig00030148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030148 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP00306.1 hypothetical protein CCACVL1_03380 [Corchorus capsula... 56 2e-06 KYP75520.1 Signal peptide peptidase-like 2B [Cajanus cajan] 55 3e-06 KHN24971.1 Signal peptide peptidase-like 2B [Glycine soja] 55 5e-06 KHN12587.1 Signal peptide peptidase-like 2B [Glycine soja] 55 5e-06 XP_003552754.1 PREDICTED: signal peptide peptidase-like 3 [Glyci... 55 5e-06 XP_003532320.1 PREDICTED: signal peptide peptidase-like 3 [Glyci... 55 5e-06 XP_007139105.1 hypothetical protein PHAVU_008G001700g [Phaseolus... 55 5e-06 XP_010107209.1 hypothetical protein L484_021730 [Morus notabilis... 53 6e-06 XP_013470513.1 signal peptide peptidase-like protein [Medicago t... 54 6e-06 XP_010927592.2 PREDICTED: signal peptide peptidase-like 2 [Elaei... 54 8e-06 KJB30040.1 hypothetical protein B456_005G128500 [Gossypium raimo... 54 8e-06 KJB30041.1 hypothetical protein B456_005G128500 [Gossypium raimo... 54 9e-06 XP_015887060.1 PREDICTED: signal peptide peptidase-like 5 [Zizip... 54 9e-06 KJB30042.1 hypothetical protein B456_005G128500 [Gossypium raimo... 54 9e-06 XP_009339896.1 PREDICTED: signal peptide peptidase-like 5 isofor... 54 9e-06 XP_017630894.1 PREDICTED: signal peptide peptidase-like 3 isofor... 54 9e-06 XP_016691072.1 PREDICTED: signal peptide peptidase-like 3 [Gossy... 54 9e-06 XP_016666830.1 PREDICTED: signal peptide peptidase-like 3 [Gossy... 54 9e-06 XP_012478442.1 PREDICTED: signal peptide peptidase-like 3 [Gossy... 54 9e-06 KJB30043.1 hypothetical protein B456_005G128500 [Gossypium raimo... 54 9e-06 >OMP00306.1 hypothetical protein CCACVL1_03380 [Corchorus capsularis] Length = 538 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+YN Sbjct: 495 ALLYLVPCTLGVTVILGLVRGELKGLWNYN 524 >KYP75520.1 Signal peptide peptidase-like 2B [Cajanus cajan] Length = 518 Score = 55.1 bits (131), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYNA 310 ALLYLVPCTLGVTV+LG RGEL SLW Y+A Sbjct: 476 ALLYLVPCTLGVTVVLGCKRGELKSLWSYDA 506 >KHN24971.1 Signal peptide peptidase-like 2B [Glycine soja] Length = 530 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL SLW+Y Sbjct: 487 ALLYLVPCTLGVTVILGCIRGELKSLWNY 515 >KHN12587.1 Signal peptide peptidase-like 2B [Glycine soja] Length = 530 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL SLW+Y Sbjct: 487 ALLYLVPCTLGVTVILGCIRGELESLWNY 515 >XP_003552754.1 PREDICTED: signal peptide peptidase-like 3 [Glycine max] KRH01823.1 hypothetical protein GLYMA_18G300700 [Glycine max] Length = 530 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL SLW+Y Sbjct: 487 ALLYLVPCTLGVTVILGCIRGELESLWNY 515 >XP_003532320.1 PREDICTED: signal peptide peptidase-like 3 [Glycine max] KRH46863.1 hypothetical protein GLYMA_08G360900 [Glycine max] Length = 530 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL SLW+Y Sbjct: 487 ALLYLVPCTLGVTVILGCIRGELKSLWNY 515 >XP_007139105.1 hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris] ESW11099.1 hypothetical protein PHAVU_008G001700g [Phaseolus vulgaris] Length = 532 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL SLW+Y Sbjct: 491 ALLYLVPCTLGVTVILGCIRGELKSLWNY 519 >XP_010107209.1 hypothetical protein L484_021730 [Morus notabilis] EXC14233.1 hypothetical protein L484_021730 [Morus notabilis] Length = 182 Score = 53.1 bits (126), Expect = 6e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTV+LG +RGEL LW+Y Sbjct: 58 ALLYLVPCTLGVTVVLGLIRGELKQLWNY 86 >XP_013470513.1 signal peptide peptidase-like protein [Medicago truncatula] KEH44551.1 signal peptide peptidase-like protein [Medicago truncatula] Length = 523 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYNA 310 ALLYLVPCTLGVTVILG +RGE+ SLW+ NA Sbjct: 482 ALLYLVPCTLGVTVILGCIRGEMKSLWNCNA 512 >XP_010927592.2 PREDICTED: signal peptide peptidase-like 2 [Elaeis guineensis] Length = 336 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVT+ILG +RGELN LW++ Sbjct: 295 ALLYLVPCTLGVTIILGGIRGELNELWNF 323 >KJB30040.1 hypothetical protein B456_005G128500 [Gossypium raimondii] Length = 487 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 444 ALLYLVPCTLGVTVILGLVRGELKELWNYS 473 >KJB30041.1 hypothetical protein B456_005G128500 [Gossypium raimondii] Length = 531 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 488 ALLYLVPCTLGVTVILGLVRGELKELWNYS 517 >XP_015887060.1 PREDICTED: signal peptide peptidase-like 5 [Ziziphus jujuba] Length = 532 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDY 316 ALLYLVPCTLGVTVILG +RGEL LW+Y Sbjct: 492 ALLYLVPCTLGVTVILGSIRGELRELWNY 520 >KJB30042.1 hypothetical protein B456_005G128500 [Gossypium raimondii] Length = 534 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 491 ALLYLVPCTLGVTVILGLVRGELKELWNYS 520 >XP_009339896.1 PREDICTED: signal peptide peptidase-like 5 isoform X2 [Pyrus x bretschneideri] Length = 536 Score = 53.9 bits (128), Expect = 9e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYNA 310 ALLYLVPCTLGVTVILG +R EL LWDY A Sbjct: 491 ALLYLVPCTLGVTVILGLIRRELKQLWDYGA 521 >XP_017630894.1 PREDICTED: signal peptide peptidase-like 3 isoform X1 [Gossypium arboreum] XP_017630895.1 PREDICTED: signal peptide peptidase-like 3 isoform X2 [Gossypium arboreum] Length = 537 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 494 ALLYLVPCTLGVTVILGLVRGELKELWNYS 523 >XP_016691072.1 PREDICTED: signal peptide peptidase-like 3 [Gossypium hirsutum] Length = 537 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 494 ALLYLVPCTLGVTVILGLVRGELKELWNYS 523 >XP_016666830.1 PREDICTED: signal peptide peptidase-like 3 [Gossypium hirsutum] Length = 537 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 494 ALLYLVPCTLGVTVILGLVRGELKELWNYS 523 >XP_012478442.1 PREDICTED: signal peptide peptidase-like 3 [Gossypium raimondii] XP_012478443.1 PREDICTED: signal peptide peptidase-like 3 [Gossypium raimondii] XP_012478444.1 PREDICTED: signal peptide peptidase-like 3 [Gossypium raimondii] KJB30038.1 hypothetical protein B456_005G128500 [Gossypium raimondii] KJB30039.1 hypothetical protein B456_005G128500 [Gossypium raimondii] Length = 537 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 494 ALLYLVPCTLGVTVILGLVRGELKELWNYS 523 >KJB30043.1 hypothetical protein B456_005G128500 [Gossypium raimondii] Length = 538 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 402 ALLYLVPCTLGVTVILGRMRGELNSLWDYN 313 ALLYLVPCTLGVTVILG +RGEL LW+Y+ Sbjct: 495 ALLYLVPCTLGVTVILGLVRGELKELWNYS 524