BLASTX nr result
ID: Glycyrrhiza35_contig00030064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030064 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_027526835.1 hypothetical protein [Bradyrhizobium sp. Ec3.3] 65 8e-12 >WP_027526835.1 hypothetical protein [Bradyrhizobium sp. Ec3.3] Length = 116 Score = 65.5 bits (158), Expect = 8e-12 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +2 Query: 2 TAEADALPTSERVNPAAPNAGTAALVTRFRVGACFTRGIVASS 130 TA ADALP SE+V+PAAPNAGTAAL TRF ACFTR +VASS Sbjct: 6 TAAADALPASEKVSPAAPNAGTAALATRFFFDACFTRCMVASS 48