BLASTX nr result
ID: Glycyrrhiza35_contig00030041
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030041 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014623551.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glyc... 74 2e-13 XP_007147415.1 hypothetical protein PHAVU_006G122600g [Phaseolus... 74 2e-13 KRH36896.1 hypothetical protein GLYMA_09G030300 [Glycine max] 72 9e-13 XP_003533104.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isofo... 72 9e-13 XP_014519092.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vigna rad... 71 2e-12 XP_017437252.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vigna ang... 71 2e-12 XP_004486510.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer ari... 71 2e-12 XP_019460002.1 PREDICTED: UDP-arabinose 4-epimerase 1 isoform X1... 71 2e-12 GAU41520.1 hypothetical protein TSUD_302590 [Trifolium subterran... 71 3e-12 XP_013463085.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medica... 70 5e-12 XP_015959414.1 PREDICTED: LOW QUALITY PROTEIN: UDP-arabinose 4-e... 70 6e-12 XP_013463086.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medica... 70 8e-12 KYP62553.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] 69 1e-11 XP_016197816.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Arachis i... 69 2e-11 XP_019419291.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isofo... 68 4e-11 XP_019426467.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Lupi... 67 7e-11 XP_015900710.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Ziziphus ... 67 9e-11 XP_004293701.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 [... 65 3e-10 XP_004504172.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Cice... 64 6e-10 KYP37603.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] 64 8e-10 >XP_014623551.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glycine max] XP_014623552.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Glycine max] KHN14279.1 UDP-arabinose 4-epimerase 1 [Glycine soja] KRH11870.1 hypothetical protein GLYMA_15G136000 [Glycine max] KRH11871.1 hypothetical protein GLYMA_15G136000 [Glycine max] Length = 415 Score = 73.9 bits (180), Expect = 2e-13 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF+R+RSQPR+TR MSLGGMDYVDPKRKGNFVGKV IK+SP Sbjct: 1 MLNFNRTRSQPRSTRSMSLGGMDYVDPKRKGNFVGKVFLAAALTALCIIMIKRSP 55 >XP_007147415.1 hypothetical protein PHAVU_006G122600g [Phaseolus vulgaris] XP_007147416.1 hypothetical protein PHAVU_006G122600g [Phaseolus vulgaris] ESW19409.1 hypothetical protein PHAVU_006G122600g [Phaseolus vulgaris] ESW19410.1 hypothetical protein PHAVU_006G122600g [Phaseolus vulgaris] Length = 415 Score = 73.9 bits (180), Expect = 2e-13 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF+R+RSQPR+TR MSLGGMDYVDPKRKGNFVGKV IK+SP Sbjct: 1 MLNFARTRSQPRSTRSMSLGGMDYVDPKRKGNFVGKVFLAAALTALCIIMIKRSP 55 >KRH36896.1 hypothetical protein GLYMA_09G030300 [Glycine max] Length = 414 Score = 72.4 bits (176), Expect = 9e-13 Identities = 37/55 (67%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF+R RSQPR TR MSLGGMDYVDPKRKGNFVGKV IK+SP Sbjct: 1 MLNFNRIRSQPRTTRSMSLGGMDYVDPKRKGNFVGKVFLAAALTALCIIMIKRSP 55 >XP_003533104.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Glycine max] XP_014617358.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Glycine max] KRH36892.1 hypothetical protein GLYMA_09G030300 [Glycine max] KRH36893.1 hypothetical protein GLYMA_09G030300 [Glycine max] KRH36894.1 hypothetical protein GLYMA_09G030300 [Glycine max] KRH36895.1 hypothetical protein GLYMA_09G030300 [Glycine max] Length = 415 Score = 72.4 bits (176), Expect = 9e-13 Identities = 37/55 (67%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF+R RSQPR TR MSLGGMDYVDPKRKGNFVGKV IK+SP Sbjct: 1 MLNFNRIRSQPRTTRSMSLGGMDYVDPKRKGNFVGKVFLAAALTALCIIMIKRSP 55 >XP_014519092.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vigna radiata var. radiata] XP_014519094.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vigna radiata var. radiata] Length = 415 Score = 71.2 bits (173), Expect = 2e-12 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSR+RSQPR+TR MSLGGMDYVDPKRK N+VGK+ IK+SP Sbjct: 1 MLNFSRTRSQPRSTRSMSLGGMDYVDPKRKSNYVGKIFLAAALTALCIIMIKRSP 55 >XP_017437252.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Vigna angularis] KOM53082.1 hypothetical protein LR48_Vigan09g174100 [Vigna angularis] BAT87733.1 hypothetical protein VIGAN_05112900 [Vigna angularis var. angularis] Length = 415 Score = 71.2 bits (173), Expect = 2e-12 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSR+RSQPR+TR MSLGGMDYVDPKRK N+VGK+ IK+SP Sbjct: 1 MLNFSRTRSQPRSTRSMSLGGMDYVDPKRKSNYVGKIFLAAALTALCIIMIKRSP 55 >XP_004486510.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer arietinum] XP_012570129.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Cicer arietinum] Length = 415 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/55 (65%), Positives = 38/55 (69%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSR+RSQPR R MSLGGMDYVDPKRKGNF GKV IK+SP Sbjct: 1 MLNFSRARSQPRGARSMSLGGMDYVDPKRKGNFAGKVFLVAALTALCIFVIKRSP 55 >XP_019460002.1 PREDICTED: UDP-arabinose 4-epimerase 1 isoform X1 [Lupinus angustifolius] OIW18078.1 hypothetical protein TanjilG_08548 [Lupinus angustifolius] Length = 416 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF RSRSQPR TRP+++GGMDY DPKRKGNFVGKV +K+SP Sbjct: 1 MLNFVRSRSQPRVTRPITMGGMDYADPKRKGNFVGKVLLAAALTSLCIIMLKQSP 55 >GAU41520.1 hypothetical protein TSUD_302590 [Trifolium subterraneum] Length = 412 Score = 70.9 bits (172), Expect = 3e-12 Identities = 36/55 (65%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSRSR+QPRA R MSLGGMDYVD KRKGNF+GKV IK+SP Sbjct: 1 MLNFSRSRNQPRAARSMSLGGMDYVDQKRKGNFIGKVFLLAALTALCILVIKRSP 55 >XP_013463085.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] KEH37131.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] Length = 301 Score = 69.7 bits (169), Expect = 5e-12 Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSR+RSQPRA R MSLGGMDYVDPK+KGN +GKV IK+SP Sbjct: 1 MLNFSRARSQPRAARSMSLGGMDYVDPKKKGNLLGKVFLVAALTALCILVIKRSP 55 >XP_015959414.1 PREDICTED: LOW QUALITY PROTEIN: UDP-arabinose 4-epimerase 1 [Arachis duranensis] Length = 418 Score = 70.1 bits (170), Expect = 6e-12 Identities = 35/55 (63%), Positives = 38/55 (69%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLN RSRSQPRATR MSLGGMDYVDPKRKGN+ GK+ IK+SP Sbjct: 1 MLNIGRSRSQPRATRAMSLGGMDYVDPKRKGNYFGKILLAAALTTLCIIMIKRSP 55 >XP_013463086.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] KEH37130.1 UDP-D-glucose/UDP-D-galactose 4-epimerase [Medicago truncatula] Length = 412 Score = 69.7 bits (169), Expect = 8e-12 Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNFSR+RSQPRA R MSLGGMDYVDPK+KGN +GKV IK+SP Sbjct: 1 MLNFSRARSQPRAARSMSLGGMDYVDPKKKGNLLGKVFLVAALTALCILVIKRSP 55 >KYP62553.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] Length = 415 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKV 56 MLNF+R+RSQPR+TR +SLGGMDYVDPKRK NFVGKV Sbjct: 1 MLNFARTRSQPRSTRSLSLGGMDYVDPKRKSNFVGKV 37 >XP_016197816.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Arachis ipaensis] XP_016197817.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Arachis ipaensis] Length = 415 Score = 68.6 bits (166), Expect = 2e-11 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLN RSRSQPRATR MSLGGMDY DPKRKGN+ GK+ IK+SP Sbjct: 1 MLNIGRSRSQPRATRAMSLGGMDYADPKRKGNYFGKILLAAALTTLCIIMIKRSP 55 >XP_019419291.1 PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Lupinus angustifolius] OIV95960.1 hypothetical protein TanjilG_27064 [Lupinus angustifolius] Length = 415 Score = 67.8 bits (164), Expect = 4e-11 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF RSR+Q RATR +S+GG+DYVDPKRKGNFVGKV IK+SP Sbjct: 1 MLNFGRSRTQSRATRSISMGGVDYVDPKRKGNFVGKVFLAAVLTTLCIIVIKRSP 55 >XP_019426467.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Lupinus angustifolius] XP_019426468.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Lupinus angustifolius] Length = 415 Score = 67.0 bits (162), Expect = 7e-11 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 M NF RSR+QPRATR MS+GGMDYVDPKRKGNF KV IK+SP Sbjct: 1 MFNFGRSRTQPRATRSMSMGGMDYVDPKRKGNFFVKVFLAAVLTILCIFLIKRSP 55 >XP_015900710.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Ziziphus jujuba] XP_015900711.1 PREDICTED: UDP-arabinose 4-epimerase 1 [Ziziphus jujuba] Length = 417 Score = 66.6 bits (161), Expect = 9e-11 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF R+R+Q R+ RPMSLGGMDY DPKRK NFVGK+ +KKSP Sbjct: 1 MLNFGRARTQQRSGRPMSLGGMDYADPKRKNNFVGKILLAATLTALCIVMLKKSP 55 >XP_004293701.1 PREDICTED: probable UDP-arabinose 4-epimerase 3 [Fragaria vesca subsp. vesca] Length = 418 Score = 65.1 bits (157), Expect = 3e-10 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF+R R + R+TRPMSLGGMDY DPKRK NFVGK+ +K+SP Sbjct: 1 MLNFARGRRESRSTRPMSLGGMDYPDPKRKNNFVGKIILAAALTALCIIMLKQSP 55 >XP_004504172.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Cicer arietinum] XP_004504173.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Cicer arietinum] XP_004504175.1 PREDICTED: UDP-arabinose 4-epimerase 1-like [Cicer arietinum] Length = 416 Score = 64.3 bits (155), Expect = 6e-10 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF RSR+Q RATRP ++G MDY DPKRKGNF+GKV IK+SP Sbjct: 1 MLNFVRSRTQARATRPNTMGTMDYADPKRKGNFIGKVFLAAALTTICIIMIKRSP 55 >KYP37603.1 UDP-arabinose 4-epimerase 1 [Cajanus cajan] Length = 416 Score = 63.9 bits (154), Expect = 8e-10 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -1 Query: 166 MLNFSRSRSQPRATRPMSLGGMDYVDPKRKGNFVGKVXXXXXXXXXXXXXIKKSP 2 MLNF RSR+Q RA R ++GGMDY DPKRKGNFVGKV IK+SP Sbjct: 1 MLNFGRSRNQSRAARATAMGGMDYADPKRKGNFVGKVFLAAVLTTLCIIMIKRSP 55