BLASTX nr result
ID: Glycyrrhiza35_contig00030039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00030039 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47648.1 hypothetical protein TSUD_27720 [Trifolium subterraneum] 41 7e-07 GAU10666.1 hypothetical protein TSUD_425710, partial [Trifolium ... 42 1e-06 GAU17063.1 hypothetical protein TSUD_105620 [Trifolium subterran... 43 2e-06 GAU34195.1 hypothetical protein TSUD_162960 [Trifolium subterran... 42 3e-06 GAU16646.1 hypothetical protein TSUD_325960 [Trifolium subterran... 42 3e-06 GAU23820.1 hypothetical protein TSUD_27290 [Trifolium subterraneum] 41 5e-06 GAU30135.1 hypothetical protein TSUD_360280 [Trifolium subterran... 41 9e-06 >GAU47648.1 hypothetical protein TSUD_27720 [Trifolium subterraneum] Length = 521 Score = 41.2 bits (95), Expect(2) = 7e-07 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+A++HGL+ AW L +++ YS+S Sbjct: 401 IGFSNILHAELMALYHGLLLAWQLNIKELWCYSDS 435 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 20/38 (52%), Positives = 25/38 (65%) Frame = -3 Query: 216 HRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 H + A++ IK +L REW V+ HT REGN CAD LA Sbjct: 450 HHYAAILLNIKDILAREW-RVNIAHTFREGNACADYLA 486 >GAU10666.1 hypothetical protein TSUD_425710, partial [Trifolium subterraneum] Length = 157 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+AI+HGLV AW L + + YS+S Sbjct: 48 IGHSNILHAELLAIYHGLVLAWELDIKDLYCYSDS 82 Score = 37.4 bits (85), Expect(2) = 1e-06 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 V+ H + A++ IK +L R W V HT REGN CAD LA Sbjct: 93 VNEWHHYAAIIYNIKDILSRNW-RVRLVHTLREGNNCADFLA 133 >GAU17063.1 hypothetical protein TSUD_105620 [Trifolium subterraneum] Length = 440 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+A++HGLV AW + + ++ YS+S Sbjct: 320 IGFSNILHAELLAVYHGLVLAWDMDIKDLICYSDS 354 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 ++ H A++ IK +L R+W V HT REGN CAD LA Sbjct: 365 INEWHHFAAILQNIKDILARDW-RVTVAHTLREGNACADYLA 405 >GAU34195.1 hypothetical protein TSUD_162960 [Trifolium subterraneum] Length = 168 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+AI+HGLV AW L + + YS+S Sbjct: 48 IGHSNILHAELLAIYHGLVLAWELDIKDLCCYSDS 82 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 20/42 (47%), Positives = 24/42 (57%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 V+ H + A++ IK L R W V HT REGN CAD LA Sbjct: 93 VNEWHHYAAIIYNIKDFLSRNW-RVRLVHTLREGNNCADFLA 133 >GAU16646.1 hypothetical protein TSUD_325960 [Trifolium subterraneum] Length = 157 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+AI+HGLV AW L + + YS+S Sbjct: 37 IGHSNILHAELLAIYHGLVLAWELDIKDLCCYSDS 71 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 20/42 (47%), Positives = 24/42 (57%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 V+ H + A++ IK L R W V HT REGN CAD LA Sbjct: 82 VNEWHHYAAIIYNIKDFLSRNW-RVRLVHTLREGNNCADFLA 122 >GAU23820.1 hypothetical protein TSUD_27290 [Trifolium subterraneum] Length = 168 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = -1 Query: 341 LGYSDCLRAELIAIFHGLVAAWSLGHRQILLYSNS 237 +G+S+ L AEL+A++HGLV W L + + YS+S Sbjct: 48 IGFSNILHAELLAVYHGLVLVWELNIKDLWCYSDS 82 Score = 36.6 bits (83), Expect(2) = 5e-06 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 V+ H + A++ IK +L R W V HT REGN CAD LA Sbjct: 93 VNEWHHYAAIIYNIKDLLTRNW-RVKLMHTLREGNTCADFLA 133 >GAU30135.1 hypothetical protein TSUD_360280 [Trifolium subterraneum] Length = 479 Score = 41.2 bits (95), Expect(2) = 9e-06 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = -3 Query: 228 VHPQHRHGALVCRIKVVL*REWGEVHPCHT*REGNFCADALA 103 V P HR + RIK +L R+W EV HT REGN CAD LA Sbjct: 349 VTPHHRFANEIHRIKKLLARDW-EVTISHTLREGNVCADVLA 389 Score = 35.4 bits (80), Expect(2) = 9e-06 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 323 LRAELIAIFHGLVAAWSLGHRQILLYSNSTM 231 L AE++AI+HGL W G R++L YS+S + Sbjct: 310 LFAEIMAIWHGLELCWERGFRKVLCYSDSLL 340