BLASTX nr result
ID: Glycyrrhiza35_contig00029858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00029858 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 2e-42 GAU44488.1 hypothetical protein TSUD_12990 [Trifolium subterraneum] 150 9e-42 XP_013466859.1 PPR containing plant protein [Medicago truncatula... 146 2e-39 XP_013466853.1 pentatricopeptide (PPR) repeat protein [Medicago ... 134 4e-37 KHN29571.1 Pentatricopeptide repeat-containing protein, mitochon... 137 4e-36 XP_006587955.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 7e-36 KRH40861.1 hypothetical protein GLYMA_09G282100 [Glycine max] KR... 137 7e-36 KHN44055.1 Pentatricopeptide repeat-containing protein, mitochon... 133 2e-35 XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing pr... 133 1e-34 XP_016175635.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 2e-33 XP_015939474.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 2e-33 KYP48845.1 hypothetical protein KK1_029488 [Cajanus cajan] KYP78... 127 2e-33 XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 3e-33 XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 3e-33 XP_007153088.1 hypothetical protein PHAVU_003G005900g [Phaseolus... 126 4e-32 XP_017419440.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 1e-29 XP_012077805.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 7e-29 XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 1e-27 EEF31203.1 pentatricopeptide repeat-containing protein, putative... 114 2e-27 OAY27443.1 hypothetical protein MANES_16G125800 [Manihot esculen... 111 2e-26 >XP_004517198.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012570098.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] XP_012567888.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Cicer arietinum] Length = 551 Score = 154 bits (390), Expect = 2e-42 Identities = 75/96 (78%), Positives = 84/96 (87%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYAIKDEVQEVLK+YYEMEY+SMCPGLSV++ +I+CLCR GKLED+EKYLRIMKGR L P Sbjct: 456 GYAIKDEVQEVLKIYYEMEYKSMCPGLSVYSSMIKCLCRFGKLEDSEKYLRIMKGRSLVP 515 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL*HS 288 NV+IYE LI HVQKGN RALQL +EMASLE HS Sbjct: 516 NVNIYETLIACHVQKGNNDRALQLRNEMASLESQHS 551 >GAU44488.1 hypothetical protein TSUD_12990 [Trifolium subterraneum] Length = 443 Score = 150 bits (380), Expect = 9e-42 Identities = 73/95 (76%), Positives = 82/95 (86%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA DEVQ VLK+YYEMEY+SMCPGL V++ +IQC CRLGKL+DAEKYLRIMKGR L P Sbjct: 348 GYARNDEVQGVLKMYYEMEYKSMCPGLRVYSSMIQCFCRLGKLDDAEKYLRIMKGRSLVP 407 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL*H 285 NV IYE LIT+H+QKGNG RALQL +EMASLEL H Sbjct: 408 NVTIYETLITAHMQKGNGDRALQLRNEMASLELQH 442 >XP_013466859.1 PPR containing plant protein [Medicago truncatula] KEH40900.1 PPR containing plant protein [Medicago truncatula] Length = 547 Score = 146 bits (368), Expect = 2e-39 Identities = 71/93 (76%), Positives = 80/93 (86%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA KDEVQ VLK+YYEMEY+SMCPGLSVF+ +IQCLCR GK++DAEKYLRIMKGRLL P Sbjct: 452 GYARKDEVQGVLKIYYEMEYKSMCPGLSVFSSMIQCLCRCGKVDDAEKYLRIMKGRLLAP 511 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 N+ IYE LI H+ KGN RALQL +EMASLEL Sbjct: 512 NLSIYETLIAGHMLKGNVERALQLRNEMASLEL 544 >XP_013466853.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH40894.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 263 Score = 134 bits (338), Expect = 4e-37 Identities = 68/89 (76%), Positives = 74/89 (83%) Frame = +1 Query: 13 KDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTPNVDI 192 KDEVQ VLK YYEMEY+SMC GLSV + +IQCLCR GK++DAEK LRIMKGR L PNV I Sbjct: 172 KDEVQGVLKRYYEMEYKSMCWGLSVVSSMIQCLCRCGKVDDAEKCLRIMKGRSLAPNVGI 231 Query: 193 YEALITSHVQKGNGVRALQLHDEMASLEL 279 YE LIT HVQKGN VRA QL +EMASLEL Sbjct: 232 YETLITCHVQKGNSVRAFQLRNEMASLEL 260 >KHN29571.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 512 Score = 137 bits (344), Expect = 4e-36 Identities = 65/93 (69%), Positives = 77/93 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYR + PGLSVF I+QC CR GK+EDAEKYLRIMKGRL+ P Sbjct: 420 GYARKEEVQEVLKLYYEMEYRCVSPGLSVFGTIVQCFCRCGKVEDAEKYLRIMKGRLVRP 479 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +Y+ALI +++KG RAL L DEMASLE+ Sbjct: 480 DVSVYQALIDGYMKKGESARALHLRDEMASLEV 512 >XP_006587955.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Glycine max] XP_003533688.2 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Glycine max] XP_014617971.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Glycine max] XP_014617972.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Glycine max] Length = 554 Score = 137 bits (344), Expect = 7e-36 Identities = 65/93 (69%), Positives = 77/93 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYR + PGLSVF I+QC CR GK+EDAEKYLRIMKGRL+ P Sbjct: 462 GYARKEEVQEVLKLYYEMEYRCVSPGLSVFGTIVQCFCRCGKVEDAEKYLRIMKGRLVRP 521 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +Y+ALI +++KG RAL L DEMASLE+ Sbjct: 522 DVSVYQALIDGYMKKGESARALHLRDEMASLEV 554 >KRH40861.1 hypothetical protein GLYMA_09G282100 [Glycine max] KRH40862.1 hypothetical protein GLYMA_09G282100 [Glycine max] KRH40863.1 hypothetical protein GLYMA_09G282100 [Glycine max] KRH40864.1 hypothetical protein GLYMA_09G282100 [Glycine max] Length = 565 Score = 137 bits (344), Expect = 7e-36 Identities = 65/93 (69%), Positives = 77/93 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYR + PGLSVF I+QC CR GK+EDAEKYLRIMKGRL+ P Sbjct: 473 GYARKEEVQEVLKLYYEMEYRCVSPGLSVFGTIVQCFCRCGKVEDAEKYLRIMKGRLVRP 532 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +Y+ALI +++KG RAL L DEMASLE+ Sbjct: 533 DVSVYQALIDGYMKKGESARALHLRDEMASLEV 565 >KHN44055.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 392 Score = 133 bits (335), Expect = 2e-35 Identities = 63/93 (67%), Positives = 77/93 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYR + PGLSVF I++C CR GK+EDAEKYLRIMKGRL+ P Sbjct: 300 GYARKEEVQEVLKLYYEMEYRCVSPGLSVFMTIVRCFCRCGKVEDAEKYLRIMKGRLVRP 359 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +Y+ LI +++KG RAL+L DEMASLE+ Sbjct: 360 DVSVYKVLIDGYMKKGESARALRLRDEMASLEV 392 >XP_019426560.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Lupinus angustifolius] OIV90410.1 hypothetical protein TanjilG_00054 [Lupinus angustifolius] Length = 535 Score = 133 bits (334), Expect = 1e-34 Identities = 66/92 (71%), Positives = 76/92 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA D++QEVLKLYYEMEY+SM PGLSVF IIQ LC GKLEDAEKYLRIMK R LTP Sbjct: 443 GYAKNDKIQEVLKLYYEMEYKSMSPGLSVFTSIIQSLCHCGKLEDAEKYLRIMKDRSLTP 502 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLE 276 NV IY AL+ S++Q+G+ +RAL L +EMASLE Sbjct: 503 NVSIYMALVASYMQEGDSLRALHLRNEMASLE 534 >XP_016175635.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X2 [Arachis ipaensis] Length = 480 Score = 129 bits (325), Expect = 2e-33 Identities = 65/91 (71%), Positives = 73/91 (80%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA KDE+QEVLKLYYEMEYRSM PGLSVF IIQCLC GKLEDA+KYL IMKG+ LTP Sbjct: 386 GYAKKDEIQEVLKLYYEMEYRSMSPGLSVFTSIIQCLCHCGKLEDADKYLWIMKGQPLTP 445 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASL 273 +V IY+ LI + QKG +RAL L +EM SL Sbjct: 446 SVTIYKTLIAGYRQKGYSIRALHLQNEMDSL 476 >XP_015939474.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X2 [Arachis duranensis] Length = 480 Score = 129 bits (325), Expect = 2e-33 Identities = 65/91 (71%), Positives = 73/91 (80%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA KDE+QEVLKLYYEMEYRSM PGLSVF IIQCLC GKLEDA+KYL IMKG+ LTP Sbjct: 386 GYAKKDEIQEVLKLYYEMEYRSMSPGLSVFTSIIQCLCHCGKLEDADKYLWIMKGQPLTP 445 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASL 273 +V IY+ LI + QKG +RAL L +EM SL Sbjct: 446 SVTIYKTLIAGYRQKGYSIRALHLQNEMDSL 476 >KYP48845.1 hypothetical protein KK1_029488 [Cajanus cajan] KYP78895.1 hypothetical protein KK1_049451 [Cajanus cajan] Length = 369 Score = 127 bits (320), Expect = 2e-33 Identities = 62/93 (66%), Positives = 77/93 (82%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYRS+ PGL VF II+CLCR GK+EDAE+YLRIMKGR ++P Sbjct: 277 GYAEKEEVQEVLKLYYEMEYRSVSPGLLVFVAIIRCLCRCGKVEDAERYLRIMKGRSVSP 336 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +YEALI + +KG+ +A+ L +EMASL L Sbjct: 337 DVTVYEALIDGYAKKGDSGKAICLREEMASLVL 369 >XP_016175627.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175628.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175629.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175631.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175633.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] XP_016175634.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis ipaensis] Length = 547 Score = 129 bits (325), Expect = 3e-33 Identities = 65/91 (71%), Positives = 73/91 (80%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA KDE+QEVLKLYYEMEYRSM PGLSVF IIQCLC GKLEDA+KYL IMKG+ LTP Sbjct: 453 GYAKKDEIQEVLKLYYEMEYRSMSPGLSVFTSIIQCLCHCGKLEDADKYLWIMKGQPLTP 512 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASL 273 +V IY+ LI + QKG +RAL L +EM SL Sbjct: 513 SVTIYKTLIAGYRQKGYSIRALHLQNEMDSL 543 >XP_015939464.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939465.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939466.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939467.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939468.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939469.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939470.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939472.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] XP_015939473.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial isoform X1 [Arachis duranensis] Length = 547 Score = 129 bits (325), Expect = 3e-33 Identities = 65/91 (71%), Positives = 73/91 (80%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA KDE+QEVLKLYYEMEYRSM PGLSVF IIQCLC GKLEDA+KYL IMKG+ LTP Sbjct: 453 GYAKKDEIQEVLKLYYEMEYRSMSPGLSVFTSIIQCLCHCGKLEDADKYLWIMKGQPLTP 512 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASL 273 +V IY+ LI + QKG +RAL L +EM SL Sbjct: 513 SVTIYKTLIAGYRQKGYSIRALHLQNEMDSL 543 >XP_007153088.1 hypothetical protein PHAVU_003G005900g [Phaseolus vulgaris] ESW25082.1 hypothetical protein PHAVU_003G005900g [Phaseolus vulgaris] Length = 532 Score = 126 bits (317), Expect = 4e-32 Identities = 59/93 (63%), Positives = 75/93 (80%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEY+ M PGLSVF +++CLC GK+EDAE+YLR+M+ RL+ Sbjct: 440 GYAGKEEVQEVLKLYYEMEYKRMSPGLSVFVTVVRCLCHCGKVEDAERYLRVMRERLVAV 499 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 +V +YE LI +++KGN RAL L +EMASLEL Sbjct: 500 DVSVYEELIDGYIKKGNTARALYLREEMASLEL 532 >XP_017419440.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like isoform X1 [Vigna angularis] XP_017419442.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like isoform X2 [Vigna angularis] Length = 547 Score = 120 bits (300), Expect = 1e-29 Identities = 58/93 (62%), Positives = 74/93 (79%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA K+EVQEVLKLYYEMEYR + PGLSVFA +++CL R GK+E AE+YLR+MK RL+ Sbjct: 455 GYARKEEVQEVLKLYYEMEYRRVNPGLSVFATVVRCLSRCGKVEHAERYLRVMKERLVAL 514 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMASLEL 279 + +YE LI +++KG+ RAL L +EMASLEL Sbjct: 515 DASVYEELIDGYIKKGDTARALYLREEMASLEL 547 >XP_012077805.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Jatropha curcas] KDP33174.1 hypothetical protein JCGZ_13439 [Jatropha curcas] Length = 557 Score = 117 bits (294), Expect = 7e-29 Identities = 55/90 (61%), Positives = 69/90 (76%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GY +++QEVLKLYYEMEYR++CPGL F +I+ LC GK+E AEKYLRIMKG L P Sbjct: 453 GYGRDNQIQEVLKLYYEMEYRALCPGLLAFTSLIRSLCHCGKVEQAEKYLRIMKGHSLNP 512 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMAS 270 N +IYEALIT H +KG+ A+QL++EM S Sbjct: 513 NEEIYEALITGHFKKGDKTSAVQLYNEMIS 542 >XP_015582090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582096.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] XP_015582097.1 PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial [Ricinus communis] Length = 557 Score = 114 bits (285), Expect = 1e-27 Identities = 55/90 (61%), Positives = 68/90 (75%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GY +++QEVLKLYYEMEYR + PGL VF +I+ LC GKLE AEKYLRIMKGR L P Sbjct: 453 GYERDNQIQEVLKLYYEMEYRPLSPGLLVFTPLIRSLCHCGKLEQAEKYLRIMKGRSLNP 512 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMAS 270 + +YEALI H++K + RALQL++EM S Sbjct: 513 SQQVYEALIAGHLEKSDTARALQLYNEMIS 542 >EEF31203.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 114 bits (285), Expect = 2e-27 Identities = 55/90 (61%), Positives = 68/90 (75%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GY +++QEVLKLYYEMEYR + PGL VF +I+ LC GKLE AEKYLRIMKGR L P Sbjct: 453 GYERDNQIQEVLKLYYEMEYRPLSPGLLVFTPLIRSLCHCGKLEQAEKYLRIMKGRSLNP 512 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMAS 270 + +YEALI H++K + RALQL++EM S Sbjct: 513 SQQVYEALIAGHLEKSDTARALQLYNEMIS 542 >OAY27443.1 hypothetical protein MANES_16G125800 [Manihot esculenta] OAY27444.1 hypothetical protein MANES_16G125800 [Manihot esculenta] OAY27445.1 hypothetical protein MANES_16G125800 [Manihot esculenta] Length = 558 Score = 111 bits (277), Expect = 2e-26 Identities = 54/90 (60%), Positives = 68/90 (75%) Frame = +1 Query: 1 GYAIKDEVQEVLKLYYEMEYRSMCPGLSVFALIIQCLCRLGKLEDAEKYLRIMKGRLLTP 180 GYA +++QEVLKLYYEMEYR++ PGL F +I+ LC GK E AEKYLRIMKGR L P Sbjct: 451 GYARDNQIQEVLKLYYEMEYRALNPGLLAFTSLIRILCHCGKPEQAEKYLRIMKGRCLDP 510 Query: 181 NVDIYEALITSHVQKGNGVRALQLHDEMAS 270 + +IY+ALIT H +KG+ RA L++EM S Sbjct: 511 SEEIYDALITGHFEKGDKARAHHLYNEMIS 540