BLASTX nr result
ID: Glycyrrhiza35_contig00029263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00029263 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH56141.1 hypothetical protein GLYMA_06G306100 [Glycine max] 65 2e-11 ONM24119.1 Septum-promoting GTP-binding protein 1 [Zea mays] 63 3e-11 KYP48262.1 Septum-promoting GTP-binding protein 1 [Cajanus cajan] 64 3e-11 BAJ93553.1 predicted protein, partial [Hordeum vulgare subsp. vu... 64 8e-11 XP_003539869.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 2e-10 XP_019451646.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 2e-10 XP_019465135.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 XP_008230075.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 OMO72328.1 Small GTPase superfamily, Rab type [Corchorus olitorius] 65 3e-10 KHN21238.1 Septum-promoting GTP-binding protein 1 [Glycine soja] 65 3e-10 XP_007215845.1 hypothetical protein PRUPE_ppa010253mg [Prunus pe... 65 3e-10 KCW89412.1 hypothetical protein EUGRSUZ_A01712 [Eucalyptus grandis] 65 3e-10 BAF21729.1 Os07g0522900, partial [Oryza sativa Japonica Group] B... 64 3e-10 XP_004287938.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 XP_008341998.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 XP_003527491.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 XP_002460793.1 hypothetical protein SORBIDRAFT_02g034970 [Sorghu... 63 3e-10 XP_009353268.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 XP_008379629.1 PREDICTED: septum-promoting GTP-binding protein 1... 65 3e-10 OMO75505.1 Small GTPase superfamily [Corchorus capsularis] 65 3e-10 >KRH56141.1 hypothetical protein GLYMA_06G306100 [Glycine max] Length = 107 Score = 65.5 bits (158), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 78 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 107 >ONM24119.1 Septum-promoting GTP-binding protein 1 [Zea mays] Length = 47 Score = 63.2 bits (152), Expect = 3e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLF+LPWTVERNLT+GEPIIDF Sbjct: 18 KIFKFITAKLFNLPWTVERNLTIGEPIIDF 47 >KYP48262.1 Septum-promoting GTP-binding protein 1 [Cajanus cajan] Length = 67 Score = 63.5 bits (153), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNL VGEPIIDF Sbjct: 38 KIFKFITAKLFDLPWTVERNLNVGEPIIDF 67 >BAJ93553.1 predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 105 Score = 63.5 bits (153), Expect = 8e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLF+LPWTVERNLTVGEPIIDF Sbjct: 76 KIFKFITAKLFNLPWTVERNLTVGEPIIDF 105 >XP_003539869.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] KRH25393.1 hypothetical protein GLYMA_12G099700 [Glycine max] Length = 278 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 249 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 278 >XP_019451646.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Lupinus angustifolius] OIW05939.1 hypothetical protein TanjilG_07215 [Lupinus angustifolius] Length = 281 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 252 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 281 >XP_019465135.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Lupinus angustifolius] OIV99209.1 hypothetical protein TanjilG_06514 [Lupinus angustifolius] Length = 283 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 283 >XP_008230075.1 PREDICTED: septum-promoting GTP-binding protein 1 [Prunus mume] Length = 286 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 257 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 286 >OMO72328.1 Small GTPase superfamily, Rab type [Corchorus olitorius] Length = 249 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 220 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 249 >KHN21238.1 Septum-promoting GTP-binding protein 1 [Glycine soja] Length = 293 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLTVGEPIIDF Sbjct: 264 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 293 >XP_007215845.1 hypothetical protein PRUPE_ppa010253mg [Prunus persica] Length = 257 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 228 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 257 >KCW89412.1 hypothetical protein EUGRSUZ_A01712 [Eucalyptus grandis] Length = 261 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 232 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 261 >BAF21729.1 Os07g0522900, partial [Oryza sativa Japonica Group] BAT01822.1 Os07g0522900, partial [Oryza sativa Japonica Group] Length = 168 Score = 63.5 bits (153), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLF+LPWTVERNLTVGEPIIDF Sbjct: 139 KIFKFITAKLFNLPWTVERNLTVGEPIIDF 168 >XP_004287938.1 PREDICTED: septum-promoting GTP-binding protein 1 [Fragaria vesca subsp. vesca] Length = 274 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 245 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 274 >XP_008341998.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Malus domestica] Length = 275 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 246 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 275 >XP_003527491.1 PREDICTED: septum-promoting GTP-binding protein 1-like [Glycine max] KRH56119.1 hypothetical protein GLYMA_06G304900 [Glycine max] Length = 279 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKF+TAKLFDLPWTVERNLTVGEPIIDF Sbjct: 250 KIFKFVTAKLFDLPWTVERNLTVGEPIIDF 279 >XP_002460793.1 hypothetical protein SORBIDRAFT_02g034970 [Sorghum bicolor] Length = 154 Score = 63.2 bits (152), Expect = 3e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLF+LPWTVERNLT+GEPIIDF Sbjct: 125 KIFKFITAKLFNLPWTVERNLTIGEPIIDF 154 >XP_009353268.1 PREDICTED: septum-promoting GTP-binding protein 1 [Pyrus x bretschneideri] Length = 280 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 251 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 280 >XP_008379629.1 PREDICTED: septum-promoting GTP-binding protein 1 [Malus domestica] Length = 280 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 251 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 280 >OMO75505.1 Small GTPase superfamily [Corchorus capsularis] Length = 283 Score = 65.1 bits (157), Expect = 3e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 343 KIFKFITAKLFDLPWTVERNLTVGEPIIDF 254 KIFKFITAKLFDLPWTVERNLT+GEPIIDF Sbjct: 254 KIFKFITAKLFDLPWTVERNLTIGEPIIDF 283