BLASTX nr result
ID: Glycyrrhiza35_contig00029187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00029187 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP44653.1 hypothetical protein KK1_033864 [Cajanus cajan] 246 4e-76 XP_007153123.1 hypothetical protein PHAVU_003G008700g [Phaseolus... 243 1e-73 XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-cont... 241 3e-73 XP_017426710.1 PREDICTED: putative pentatricopeptide repeat-cont... 239 2e-72 OIV93989.1 hypothetical protein TanjilG_05692 [Lupinus angustifo... 238 3e-72 XP_019420393.1 PREDICTED: putative pentatricopeptide repeat-cont... 238 5e-72 KHN23502.1 Putative pentatricopeptide repeat-containing protein,... 236 6e-72 XP_014520247.1 PREDICTED: putative pentatricopeptide repeat-cont... 238 7e-72 XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago ... 237 2e-71 XP_003529187.2 PREDICTED: putative pentatricopeptide repeat-cont... 236 3e-71 XP_016194443.1 PREDICTED: putative pentatricopeptide repeat-cont... 233 5e-70 XP_015962602.1 PREDICTED: putative pentatricopeptide repeat-cont... 233 5e-70 XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatri... 218 3e-64 XP_017192119.1 PREDICTED: putative pentatricopeptide repeat-cont... 214 4e-63 XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-cont... 214 5e-63 XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-cont... 214 6e-63 XP_018859195.1 PREDICTED: putative pentatricopeptide repeat-cont... 213 2e-62 XP_007226729.1 hypothetical protein PRUPE_ppa019364mg, partial [... 212 3e-62 ONI29870.1 hypothetical protein PRUPE_1G218200 [Prunus persica] 212 3e-62 XP_011457510.1 PREDICTED: putative pentatricopeptide repeat-cont... 210 2e-61 >KYP44653.1 hypothetical protein KK1_033864 [Cajanus cajan] Length = 659 Score = 246 bits (628), Expect = 4e-76 Identities = 111/123 (90%), Positives = 120/123 (97%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL+KGQ HFKSM +DYGIEPC+EHYTCMVWLLGRLGQFDEA Sbjct: 384 CKPNKLTFVGVLSACSNAGLLDKGQTHFKSMLQDYGIEPCVEHYTCMVWLLGRLGQFDEA 443 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCA+HVLEMEPHDDATHVLLSNMYA A Sbjct: 444 VKLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAEHVLEMEPHDDATHVLLSNMYANA 503 Query: 10 RRW 2 RRW Sbjct: 504 RRW 506 >XP_007153123.1 hypothetical protein PHAVU_003G008700g [Phaseolus vulgaris] ESW25117.1 hypothetical protein PHAVU_003G008700g [Phaseolus vulgaris] Length = 806 Score = 243 bits (619), Expect = 1e-73 Identities = 109/123 (88%), Positives = 119/123 (96%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL+KG+ HF+SM +DYGIEPCIEHYTCMVWLLGRLGQFDEA Sbjct: 531 CKPNKLTFVGVLSACSNAGLLDKGRTHFRSMLQDYGIEPCIEHYTCMVWLLGRLGQFDEA 590 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 + LIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCAQHVLEMEPHDDATHVLLSNMYAT Sbjct: 591 INLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAQHVLEMEPHDDATHVLLSNMYATE 650 Query: 10 RRW 2 RRW Sbjct: 651 RRW 653 >XP_004491510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Cicer arietinum] Length = 813 Score = 241 bits (616), Expect = 3e-73 Identities = 109/123 (88%), Positives = 119/123 (96%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTF+G+LSACSN GLL+KG AHF+SMSRDYGI+PCIEHYTCMVWLLGRLG+FDEA Sbjct: 538 CKPNKLTFIGVLSACSNVGLLDKGHAHFESMSRDYGIDPCIEHYTCMVWLLGRLGRFDEA 597 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 +KLI EIPF PSVMVWRALLGACV+HKNVDLGRVCAQHVLE+EPHDDATHVLLSNMYATA Sbjct: 598 MKLIREIPFRPSVMVWRALLGACVIHKNVDLGRVCAQHVLEIEPHDDATHVLLSNMYATA 657 Query: 10 RRW 2 +RW Sbjct: 658 KRW 660 >XP_017426710.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vigna angularis] KOM46162.1 hypothetical protein LR48_Vigan06g146800 [Vigna angularis] BAT98771.1 hypothetical protein VIGAN_10011500 [Vigna angularis var. angularis] Length = 816 Score = 239 bits (610), Expect = 2e-72 Identities = 108/123 (87%), Positives = 118/123 (95%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL+KG+ HF+SM +DYGIEPCIEHYTCMVWLLGRLGQFDEA Sbjct: 541 CKPNKLTFVGVLSACSNAGLLDKGRTHFRSMLQDYGIEPCIEHYTCMVWLLGRLGQFDEA 600 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 LIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCA+HVLEMEPHDDATHVLLSNMYAT Sbjct: 601 KNLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAKHVLEMEPHDDATHVLLSNMYATE 660 Query: 10 RRW 2 RRW Sbjct: 661 RRW 663 >OIV93989.1 hypothetical protein TanjilG_05692 [Lupinus angustifolius] Length = 773 Score = 238 bits (608), Expect = 3e-72 Identities = 110/123 (89%), Positives = 118/123 (95%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 C+PNKLTFVG+LSACSNAGLLE GQAHFKSM +DYGIEPCIEHYTCMVWLLGR G+FD A Sbjct: 498 CRPNKLTFVGVLSACSNAGLLEIGQAHFKSMLQDYGIEPCIEHYTCMVWLLGRSGKFDGA 557 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLIGEIPF+PSVMVWRALLGACV+HKNVDLGRVCAQHVL+MEPHDDATHVLLSN+YA A Sbjct: 558 VKLIGEIPFQPSVMVWRALLGACVIHKNVDLGRVCAQHVLDMEPHDDATHVLLSNIYAGA 617 Query: 10 RRW 2 RRW Sbjct: 618 RRW 620 >XP_019420393.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Lupinus angustifolius] Length = 822 Score = 238 bits (608), Expect = 5e-72 Identities = 110/123 (89%), Positives = 118/123 (95%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 C+PNKLTFVG+LSACSNAGLLE GQAHFKSM +DYGIEPCIEHYTCMVWLLGR G+FD A Sbjct: 547 CRPNKLTFVGVLSACSNAGLLEIGQAHFKSMLQDYGIEPCIEHYTCMVWLLGRSGKFDGA 606 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLIGEIPF+PSVMVWRALLGACV+HKNVDLGRVCAQHVL+MEPHDDATHVLLSN+YA A Sbjct: 607 VKLIGEIPFQPSVMVWRALLGACVIHKNVDLGRVCAQHVLDMEPHDDATHVLLSNIYAGA 666 Query: 10 RRW 2 RRW Sbjct: 667 RRW 669 >KHN23502.1 Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 717 Score = 236 bits (603), Expect = 6e-72 Identities = 109/122 (89%), Positives = 118/122 (96%) Frame = -3 Query: 367 KPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEAV 188 KPNKLTFVG+LSACSNAGLL+KG+AHFKSM +DYGIEPCIEHYTCMVWLLGR GQFDEAV Sbjct: 443 KPNKLTFVGVLSACSNAGLLDKGRAHFKSMLQDYGIEPCIEHYTCMVWLLGRSGQFDEAV 502 Query: 187 KLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATAR 8 KLIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCAQ VLEMEP DDATHVLLSNMYATA+ Sbjct: 503 KLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAQRVLEMEPQDDATHVLLSNMYATAK 562 Query: 7 RW 2 RW Sbjct: 563 RW 564 >XP_014520247.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Vigna radiata var. radiata] Length = 816 Score = 238 bits (607), Expect = 7e-72 Identities = 108/123 (87%), Positives = 117/123 (95%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL+KG+ HF+SM +DYGIEPCIEHYTCMVWLLGRLGQFDEA Sbjct: 541 CKPNKLTFVGVLSACSNAGLLDKGRTHFRSMLQDYGIEPCIEHYTCMVWLLGRLGQFDEA 600 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 LIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCAQHVLEMEPHDDATHVLLSNMYAT Sbjct: 601 KNLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAQHVLEMEPHDDATHVLLSNMYATE 660 Query: 10 RRW 2 RW Sbjct: 661 GRW 663 >XP_003617808.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AET00767.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 811 Score = 237 bits (604), Expect = 2e-71 Identities = 109/123 (88%), Positives = 118/123 (95%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL KGQAHF+SMS+DY I+PCIEHYTCMVWLLGRLG+FDEA Sbjct: 536 CKPNKLTFVGVLSACSNAGLLYKGQAHFESMSKDYDIKPCIEHYTCMVWLLGRLGRFDEA 595 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 +KLIGEI ++PSVMVWRALLGACV+HK VDLGRVCAQHVLEMEPHDDATHVLLSNMYATA Sbjct: 596 MKLIGEIAYQPSVMVWRALLGACVIHKKVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 655 Query: 10 RRW 2 RW Sbjct: 656 GRW 658 >XP_003529187.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Glycine max] KRH49498.1 hypothetical protein GLYMA_07G159200 [Glycine max] Length = 822 Score = 236 bits (603), Expect = 3e-71 Identities = 109/122 (89%), Positives = 118/122 (96%) Frame = -3 Query: 367 KPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEAV 188 KPNKLTFVG+LSACSNAGLL+KG+AHFKSM +DYGIEPCIEHYTCMVWLLGR GQFDEAV Sbjct: 548 KPNKLTFVGVLSACSNAGLLDKGRAHFKSMLQDYGIEPCIEHYTCMVWLLGRSGQFDEAV 607 Query: 187 KLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATAR 8 KLIGEIPF+PSVMVWRALLGACV+HKN+DLG+VCAQ VLEMEP DDATHVLLSNMYATA+ Sbjct: 608 KLIGEIPFQPSVMVWRALLGACVIHKNLDLGKVCAQRVLEMEPQDDATHVLLSNMYATAK 667 Query: 7 RW 2 RW Sbjct: 668 RW 669 >XP_016194443.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Arachis ipaensis] Length = 814 Score = 233 bits (594), Expect = 5e-70 Identities = 108/122 (88%), Positives = 116/122 (95%) Frame = -3 Query: 367 KPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEAV 188 KPNKLTFVG+LSACSNAGLLE+GQA FKSM +DYGIEPCIEHYTCMVWLLGRLGQFDEA Sbjct: 540 KPNKLTFVGVLSACSNAGLLERGQALFKSMLKDYGIEPCIEHYTCMVWLLGRLGQFDEAA 599 Query: 187 KLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATAR 8 KLIGEIP++PSVMVWRALLGACV+HKN+DLG VCAQ VLEMEP DDATHVLLSNMYATA+ Sbjct: 600 KLIGEIPYDPSVMVWRALLGACVIHKNIDLGSVCAQRVLEMEPDDDATHVLLSNMYATAK 659 Query: 7 RW 2 RW Sbjct: 660 RW 661 >XP_015962602.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Arachis duranensis] Length = 814 Score = 233 bits (594), Expect = 5e-70 Identities = 108/122 (88%), Positives = 116/122 (95%) Frame = -3 Query: 367 KPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEAV 188 KPNKLTFVG+LSACSNAGLLE+GQA FKSM +DYGIEPCIEHYTCMVWLLGRLGQFDEA Sbjct: 540 KPNKLTFVGVLSACSNAGLLERGQALFKSMLKDYGIEPCIEHYTCMVWLLGRLGQFDEAA 599 Query: 187 KLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATAR 8 KLIGEIP++PSVMVWRALLGACV+HKN+DLG VCAQ VLEMEP DDATHVLLSNMYATA+ Sbjct: 600 KLIGEIPYDPSVMVWRALLGACVIHKNIDLGSVCAQRVLEMEPDDDATHVLLSNMYATAK 659 Query: 7 RW 2 RW Sbjct: 660 RW 661 >XP_008222365.2 PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Prunus mume] Length = 823 Score = 218 bits (554), Expect = 3e-64 Identities = 98/123 (79%), Positives = 113/123 (91%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM ++Y +EPC+EHYTCMVWLLGR G D+A Sbjct: 548 CKPNKLTFVGILSACSNAGLLDQGQAYFNSMVQNYDVEPCVEHYTCMVWLLGRSGHLDKA 607 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLI EIPFEPSVMVWRALLGACV+H +V+LGR+ AQHVLEM+P DDATHVLLSN+YATA Sbjct: 608 VKLIQEIPFEPSVMVWRALLGACVIHNDVELGRIAAQHVLEMDPQDDATHVLLSNIYATA 667 Query: 10 RRW 2 RRW Sbjct: 668 RRW 670 >XP_017192119.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X2 [Malus domestica] Length = 792 Score = 214 bits (545), Expect = 4e-63 Identities = 96/123 (78%), Positives = 112/123 (91%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM +DY +EPCIEHYTCMVWLLGR G D+A Sbjct: 558 CKPNKLTFVGVLSACSNAGLLDQGQAYFDSMVQDYDVEPCIEHYTCMVWLLGRSGHLDKA 617 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLI EIPFEPS+MVWRALLGACV+H +V+LGR A+HVLEM+P D+ATHVLLSN+YATA Sbjct: 618 VKLINEIPFEPSIMVWRALLGACVIHNDVELGRTAAKHVLEMDPQDEATHVLLSNIYATA 677 Query: 10 RRW 2 +RW Sbjct: 678 KRW 680 >XP_009378828.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Pyrus x bretschneideri] Length = 833 Score = 214 bits (546), Expect = 5e-63 Identities = 96/123 (78%), Positives = 113/123 (91%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM +DY +EPCIEHYTCMVWLLGR G D+A Sbjct: 558 CKPNKLTFVGVLSACSNAGLLDQGQAYFDSMVQDYDVEPCIEHYTCMVWLLGRSGHLDKA 617 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLI EIPFEPS+MVWRALLGACV+H +V+LGR+ A+HVLEM+P D+ATHVLLSN+YATA Sbjct: 618 VKLINEIPFEPSIMVWRALLGACVIHNDVELGRMAAKHVLEMDPQDEATHVLLSNIYATA 677 Query: 10 RRW 2 +RW Sbjct: 678 KRW 680 >XP_008390176.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390177.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_008390178.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] XP_017192118.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial isoform X1 [Malus domestica] Length = 833 Score = 214 bits (545), Expect = 6e-63 Identities = 96/123 (78%), Positives = 112/123 (91%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM +DY +EPCIEHYTCMVWLLGR G D+A Sbjct: 558 CKPNKLTFVGVLSACSNAGLLDQGQAYFDSMVQDYDVEPCIEHYTCMVWLLGRSGHLDKA 617 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 VKLI EIPFEPS+MVWRALLGACV+H +V+LGR A+HVLEM+P D+ATHVLLSN+YATA Sbjct: 618 VKLINEIPFEPSIMVWRALLGACVIHNDVELGRTAAKHVLEMDPQDEATHVLLSNIYATA 677 Query: 10 RRW 2 +RW Sbjct: 678 KRW 680 >XP_018859195.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] XP_018859196.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] XP_018859197.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Juglans regia] Length = 834 Score = 213 bits (542), Expect = 2e-62 Identities = 96/123 (78%), Positives = 111/123 (90%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPN+LTFVG+LSACSNAGLL++GQA+F+SM DY IEPCIEHYTCMVWLLGR G D++ Sbjct: 559 CKPNQLTFVGVLSACSNAGLLDQGQAYFRSMVHDYSIEPCIEHYTCMVWLLGRSGHLDKS 618 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 +KLI +IPFEPSVMVWRALLGACV+H NV+LGR+ AQ VLEMEP D+ATHVLLSNMYA A Sbjct: 619 IKLIEQIPFEPSVMVWRALLGACVIHNNVELGRISAQRVLEMEPEDEATHVLLSNMYAAA 678 Query: 10 RRW 2 +RW Sbjct: 679 KRW 681 >XP_007226729.1 hypothetical protein PRUPE_ppa019364mg, partial [Prunus persica] Length = 824 Score = 212 bits (540), Expect = 3e-62 Identities = 96/123 (78%), Positives = 111/123 (90%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM ++Y +E C+EHYTCMVWLLGR G D+A Sbjct: 549 CKPNKLTFVGILSACSNAGLLDQGQAYFNSMVQNYNVELCVEHYTCMVWLLGRSGHLDKA 608 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 V LI EIPFEPSVMVWRALLGACV+H +V+LGR+ AQHVLEM+P DDATHVLLSN+YATA Sbjct: 609 VNLIQEIPFEPSVMVWRALLGACVIHNDVELGRIAAQHVLEMDPQDDATHVLLSNIYATA 668 Query: 10 RRW 2 RRW Sbjct: 669 RRW 671 >ONI29870.1 hypothetical protein PRUPE_1G218200 [Prunus persica] Length = 835 Score = 212 bits (540), Expect = 3e-62 Identities = 96/123 (78%), Positives = 111/123 (90%) Frame = -3 Query: 370 CKPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEA 191 CKPNKLTFVG+LSACSNAGLL++GQA+F SM ++Y +E C+EHYTCMVWLLGR G D+A Sbjct: 560 CKPNKLTFVGILSACSNAGLLDQGQAYFNSMVQNYNVELCVEHYTCMVWLLGRSGHLDKA 619 Query: 190 VKLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATA 11 V LI EIPFEPSVMVWRALLGACV+H +V+LGR+ AQHVLEM+P DDATHVLLSN+YATA Sbjct: 620 VNLIQEIPFEPSVMVWRALLGACVIHNDVELGRIAAQHVLEMDPQDDATHVLLSNIYATA 679 Query: 10 RRW 2 RRW Sbjct: 680 RRW 682 >XP_011457510.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Fragaria vesca subsp. vesca] XP_004310131.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial [Fragaria vesca subsp. vesca] Length = 825 Score = 210 bits (535), Expect = 2e-61 Identities = 96/122 (78%), Positives = 109/122 (89%) Frame = -3 Query: 367 KPNKLTFVGLLSACSNAGLLEKGQAHFKSMSRDYGIEPCIEHYTCMVWLLGRLGQFDEAV 188 KPNKLTFVG+LSACSNAGLL++G A+F M DY IEPC+EHYTCMVWLLGR GQ D+AV Sbjct: 551 KPNKLTFVGVLSACSNAGLLDQGHAYFNCMVGDYDIEPCMEHYTCMVWLLGRSGQLDKAV 610 Query: 187 KLIGEIPFEPSVMVWRALLGACVVHKNVDLGRVCAQHVLEMEPHDDATHVLLSNMYATAR 8 KLI EIPFEPS MVWRALLGACV+H NV+LGR+ AQHVLEM+P D+ATHVLLSN+YATA+ Sbjct: 611 KLIDEIPFEPSAMVWRALLGACVIHNNVELGRISAQHVLEMDPQDEATHVLLSNLYATAK 670 Query: 7 RW 2 RW Sbjct: 671 RW 672