BLASTX nr result
ID: Glycyrrhiza35_contig00029145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00029145 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_043855246.1 PEP-CTERM sorting domain-containing protein [Brad... 59 3e-08 >WP_043855246.1 PEP-CTERM sorting domain-containing protein [Bradyrhizobium elkanii] KIU49593.1 hypothetical protein QU41_11710 [Bradyrhizobium elkanii] OCX31831.1 hypothetical protein QU42_06170 [Bradyrhizobium sp. UASWS1016] Length = 221 Score = 58.9 bits (141), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 216 MKAYLKALAVSAALLGATCVEVSAAPFTDGL 308 MK YLKA AVSAALLGATCVEVSAAPFTDGL Sbjct: 1 MKVYLKAFAVSAALLGATCVEVSAAPFTDGL 31