BLASTX nr result
ID: Glycyrrhiza35_contig00029110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00029110 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013457479.1 cytochrome P450 family protein [Medicago truncatu... 72 4e-12 ACJ85868.1 unknown [Medicago truncatula] AFK47557.1 unknown [Med... 72 4e-12 XP_004509096.1 PREDICTED: cytochrome P450 81E8-like [Cicer ariet... 69 5e-11 OIW03312.1 hypothetical protein TanjilG_16461 [Lupinus angustifo... 58 3e-07 XP_019457163.1 PREDICTED: cytochrome P450 81E8-like [Lupinus ang... 58 3e-07 XP_016185649.1 PREDICTED: cytochrome P450 81E8-like [Arachis ipa... 55 4e-06 XP_015956154.1 PREDICTED: cytochrome P450 81E8-like [Arachis dur... 55 4e-06 >XP_013457479.1 cytochrome P450 family protein [Medicago truncatula] KEH31510.1 cytochrome P450 family protein [Medicago truncatula] Length = 509 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVFLKAGEEM 259 EEIDMTEGKGATTPKLIPL+AMC+ARSN+ NKV+LK E M Sbjct: 469 EEIDMTEGKGATTPKLIPLEAMCKARSNVINKVYLKVDENM 509 >ACJ85868.1 unknown [Medicago truncatula] AFK47557.1 unknown [Medicago truncatula] Length = 509 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVFLKAGEEM 259 EEIDMTEGKGATTPKLIPL+AMC+ARSN+ NKV+LK E M Sbjct: 469 EEIDMTEGKGATTPKLIPLEAMCKARSNVINKVYLKVDENM 509 >XP_004509096.1 PREDICTED: cytochrome P450 81E8-like [Cicer arietinum] Length = 506 Score = 68.6 bits (166), Expect = 5e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVFLKAGEEM 259 +EIDMTEGKGATTPKLIPL+AMC+ARSN+ NK+FLK E + Sbjct: 462 KEIDMTEGKGATTPKLIPLEAMCKARSNVINKLFLKVDENI 502 >OIW03312.1 hypothetical protein TanjilG_16461 [Lupinus angustifolius] Length = 496 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVF 280 EEIDMTEGKGATTPK+IPL+AMC+AR I N VF Sbjct: 463 EEIDMTEGKGATTPKVIPLEAMCKARPIIINNVF 496 >XP_019457163.1 PREDICTED: cytochrome P450 81E8-like [Lupinus angustifolius] XP_019457164.1 PREDICTED: cytochrome P450 81E8-like [Lupinus angustifolius] Length = 502 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVF 280 EEIDMTEGKGATTPK+IPL+AMC+AR I N VF Sbjct: 469 EEIDMTEGKGATTPKVIPLEAMCKARPIIINNVF 502 >XP_016185649.1 PREDICTED: cytochrome P450 81E8-like [Arachis ipaensis] Length = 500 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVF 280 +EIDM+EG+GATTPKLIPL+A+C+A S+I +KVF Sbjct: 467 DEIDMSEGRGATTPKLIPLEALCKADSSIIDKVF 500 >XP_015956154.1 PREDICTED: cytochrome P450 81E8-like [Arachis duranensis] Length = 541 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -2 Query: 381 EEIDMTEGKGATTPKLIPLKAMCQARSNITNKVF 280 +EIDM+EG+GATTPKLIPL+A+C+A S+I +KVF Sbjct: 508 DEIDMSEGRGATTPKLIPLEALCKADSSIIDKVF 541