BLASTX nr result
ID: Glycyrrhiza35_contig00027999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00027999 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterran... 62 3e-10 >GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterraneum] Length = 77 Score = 62.0 bits (149), Expect = 3e-10 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +3 Query: 3 GGSDSPFLSQKREEAHKGCVNSVYAKDRKSNFTDTESPCQ*TALHPMS 146 GGSDSPF KREE KGCVNS AK+ K NFT T+SP Q T LH S Sbjct: 29 GGSDSPFFRLKREEVCKGCVNSNCAKNHKGNFTQTDSPRQETTLHSTS 76