BLASTX nr result
ID: Glycyrrhiza35_contig00027997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00027997 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-cont... 105 7e-25 XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago ... 96 2e-21 XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-cont... 87 4e-18 KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] 87 4e-18 XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-cont... 81 3e-16 XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-cont... 80 6e-16 XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-cont... 80 6e-16 XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-15 XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-cont... 79 3e-15 KRH09256.1 hypothetical protein GLYMA_16G206600 [Glycine max] 77 7e-15 KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] 76 2e-14 XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 2e-14 XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 2e-14 XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 2e-14 XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 2e-14 XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-cont... 76 2e-14 XP_003533262.1 PREDICTED: putative pentatricopeptide repeat-cont... 75 5e-14 XP_015966103.1 PREDICTED: putative pentatricopeptide repeat-cont... 75 5e-14 KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910... 75 6e-14 XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-cont... 73 2e-13 >XP_012571293.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Cicer arietinum] Length = 508 Score = 105 bits (262), Expect = 7e-25 Identities = 53/78 (67%), Positives = 63/78 (80%), Gaps = 1/78 (1%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS+ +N+NAV N+P +RT LLNSI++L DV+ AVT FH+M M PFP VKDFNFLFTF+ Sbjct: 25 SSSTTNSNAVNNNPINRTHLLNSIKTLPDVNAAVTFFHQMLTMNPFPNVKDFNFLFTFIT 84 Query: 184 -KTKRYTRAISLIKHAHS 234 KTK YT AISLIKHAHS Sbjct: 85 KKTKHYTTAISLIKHAHS 102 >XP_013459888.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH33919.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 587 Score = 95.9 bits (237), Expect = 2e-21 Identities = 46/78 (58%), Positives = 61/78 (78%), Gaps = 1/78 (1%) Frame = +1 Query: 4 SSTHSNNNAVINDP-RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFV 180 S+ H ++NAV ++P +RT LLN+IR+L++V+ AVT FH+M +KP P +KDFN LFTF+ Sbjct: 23 SNLHFSSNAVNSNPTNTRTHLLNTIRTLTNVNTAVTFFHQMLTLKPLPNIKDFNLLFTFI 82 Query: 181 AKTKRYTRAISLIKHAHS 234 KTK YT ISLIKHAHS Sbjct: 83 TKTKNYTTTISLIKHAHS 100 >XP_014629134.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 583 Score = 86.7 bits (213), Expect = 4e-18 Identities = 43/74 (58%), Positives = 53/74 (71%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 184 KTKRYTRAISLIKH 225 K K YT AISLIKH Sbjct: 103 KMKHYTTAISLIKH 116 >KRH75048.1 hypothetical protein GLYMA_01G059000 [Glycine max] Length = 608 Score = 86.7 bits (213), Expect = 4e-18 Identities = 43/74 (58%), Positives = 53/74 (71%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S H++NNA IN R+ Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 45 SDNHNHNNASINTRRA--QFLDSMRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 102 Query: 184 KTKRYTRAISLIKH 225 K K YT AISLIKH Sbjct: 103 KMKHYTTAISLIKH 116 >XP_006573154.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_003517841.2 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629146.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75063.1 hypothetical protein GLYMA_01G059900 [Glycine max] Length = 604 Score = 81.3 bits (199), Expect = 3e-16 Identities = 40/74 (54%), Positives = 50/74 (67%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 S + S + V + SR Q L+S+R+ VD A+ +H+M MKPFPCVKDFN LF+ VA Sbjct: 39 SHSSSTFSFVSDSDTSRAQFLDSMRNAKSVDVALDFYHKMVTMKPFPCVKDFNLLFSIVA 98 Query: 184 KTKRYTRAISLIKH 225 K K YT AISLIKH Sbjct: 99 KMKHYTTAISLIKH 112 >XP_014629135.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] XP_014629136.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH75044.1 hypothetical protein GLYMA_01G058700 [Glycine max] KRH75045.1 hypothetical protein GLYMA_01G058700 [Glycine max] Length = 597 Score = 80.5 bits (197), Expect = 6e-16 Identities = 42/74 (56%), Positives = 51/74 (68%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS+ + A IN SR Q L+S+R++ VD A+ +H+M MKPFPCVKDFN LF VA Sbjct: 34 SSSTFSTYASINT--SRAQFLDSLRNVKSVDVALDFYHKMVTMKPFPCVKDFNLLFGIVA 91 Query: 184 KTKRYTRAISLIKH 225 K K YT AISLIKH Sbjct: 92 KMKHYTTAISLIKH 105 >XP_019464912.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Lupinus angustifolius] Length = 609 Score = 80.5 bits (197), Expect = 6e-16 Identities = 41/77 (53%), Positives = 51/77 (66%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SS +++ +IN RT LLNSIR+L +VD A FHEM ++ P P VKDFN LF F+ Sbjct: 47 SSIEIHHDTIIN----RTHLLNSIRNLKNVDTAFNFFHEMVSINPLPSVKDFNLLFGFIV 102 Query: 184 KTKRYTRAISLIKHAHS 234 K K YT ISLIKH +S Sbjct: 103 KMKHYTTTISLIKHLYS 119 >XP_015966122.1 PREDICTED: pentatricopeptide repeat-containing protein At5g55840-like, partial [Arachis duranensis] Length = 1180 Score = 79.3 bits (194), Expect = 1e-15 Identities = 43/77 (55%), Positives = 52/77 (67%) Frame = +1 Query: 4 SSTHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVA 183 SSTH I+ + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF VA Sbjct: 7 SSTH------IHAIKDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSVA 60 Query: 184 KTKRYTRAISLIKHAHS 234 K K YT AISLIKH S Sbjct: 61 KMKHYTVAISLIKHVFS 77 Score = 70.9 bits (172), Expect = 1e-12 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + R L++SIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AISLIK+ Sbjct: 630 KDRPLLVDSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAISLIKY 689 Query: 226 AHS 234 S Sbjct: 690 LFS 692 >XP_016200436.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 600 Score = 78.6 bits (192), Expect = 3e-15 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 7/77 (9%) Frame = +1 Query: 16 SNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFT 174 S++N +D R +RTQLLNSIR+L +VD A LFH+M +M P P KDFN LF Sbjct: 34 SSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFHKMVSMNPLPSEKDFNLLFG 93 Query: 175 FVAKTKRYTRAISLIKH 225 F+ + K YT AISLIKH Sbjct: 94 FIVRMKDYTTAISLIKH 110 >KRH09256.1 hypothetical protein GLYMA_16G206600 [Glycine max] Length = 559 Score = 77.4 bits (189), Expect = 7e-15 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 6/83 (7%) Frame = +1 Query: 4 SSTH--SNNNAVINDPRSRTQLLNSIRSLSDVDGAVTL----FHEMAAMKPFPCVKDFNF 165 S+TH S + I+D +RT+LLNSIR+L D AV++ FH M + PFPC++DFN Sbjct: 22 SNTHPFSTSPPSISDAAARTRLLNSIRTLQSADAAVSVSVDFFHRMLTLNPFPCIQDFNL 81 Query: 166 LFTFVAKTKRYTRAISLIKHAHS 234 LF VAK++ + AISLIK HS Sbjct: 82 LFGIVAKSQHFATAISLIKTLHS 104 >KYP31404.1 hypothetical protein KK1_048306 [Cajanus cajan] Length = 586 Score = 76.3 bits (186), Expect = 2e-14 Identities = 38/76 (50%), Positives = 50/76 (65%) Frame = +1 Query: 7 STHSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAK 186 S+ + + V RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK Sbjct: 26 SSSTFSTLVSGSDTRRTKLLGSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAK 85 Query: 187 TKRYTRAISLIKHAHS 234 K YT ISL KH +S Sbjct: 86 MKHYTTVISLTKHMYS 101 >XP_016204033.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis ipaensis] Length = 600 Score = 76.3 bits (186), Expect = 2e-14 Identities = 36/67 (53%), Positives = 47/67 (70%) Frame = +1 Query: 34 INDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAIS 213 I+ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K K YT AIS Sbjct: 43 IDTIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAIS 102 Query: 214 LIKHAHS 234 LIKH S Sbjct: 103 LIKHLFS 109 >XP_016204039.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 587 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 81 Query: 190 KRYTRAISLIKHAHS 234 K YT AISLIKH S Sbjct: 82 KHYTAAISLIKHLFS 96 >XP_016204038.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 589 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFLF+ + K Sbjct: 24 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMLSMNPLPCVNDFNFLFSSIVKM 83 Query: 190 KRYTRAISLIKHAHS 234 K YT AISLIKH S Sbjct: 84 KHYTAAISLIKHLFS 98 >XP_016203976.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis ipaensis] Length = 597 Score = 75.9 bits (185), Expect = 2e-14 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + RT L+NSIR+L ++D A+ LF +M +M P PCVKDFN LF + K K YT AISLIKH Sbjct: 44 KDRTYLINSIRNLQNLDPALHLFQQMLSMNPLPCVKDFNLLFGSIVKMKHYTVAISLIKH 103 Query: 226 AHS 234 S Sbjct: 104 VFS 106 >XP_015965999.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 600 Score = 75.9 bits (185), Expect = 2e-14 Identities = 40/82 (48%), Positives = 52/82 (63%), Gaps = 7/82 (8%) Frame = +1 Query: 1 FSSTHSNNNAVINDPR-------SRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDF 159 ++ S++N +D R +RTQLLNSIR+L +VD A LF +M +M P P KDF Sbjct: 29 YNLAFSSSNYCTHDSRIGVHKTVNRTQLLNSIRNLKNVDSAFNLFRKMVSMNPLPSEKDF 88 Query: 160 NFLFTFVAKTKRYTRAISLIKH 225 N LF F+ + K YT AISLIKH Sbjct: 89 NLLFGFIVRMKDYTTAISLIKH 110 >XP_003533262.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] KRH38755.1 hypothetical protein GLYMA_09G156000 [Glycine max] Length = 594 Score = 75.1 bits (183), Expect = 5e-14 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = +1 Query: 1 FSSTHSNNNAVINDPRSRTQLLNSIRSLSDVDG--AVTLFHEMAAMKPFPCVKDFNFLFT 174 +S S + I+D RT LLNSIR+L D AV FH M + PFPC++DFN LF Sbjct: 23 YSHPFSTSPPPISDAAHRTLLLNSIRTLETADAVVAVDFFHRMLTLTPFPCIQDFNLLFG 82 Query: 175 FVAKTKRYTRAISLIKHAHS 234 VAK++ Y AISLIK HS Sbjct: 83 LVAKSQHYATAISLIKILHS 102 >XP_015966103.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X1 [Arachis duranensis] XP_015966104.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial isoform X2 [Arachis duranensis] Length = 600 Score = 75.1 bits (183), Expect = 5e-14 Identities = 34/63 (53%), Positives = 46/63 (73%) Frame = +1 Query: 46 RSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKH 225 + R L++SIR+L ++D A+ LFH+M +M P PCV DFNFLF+ + K K YT AISLIK+ Sbjct: 47 KDRPHLVDSIRNLQNLDSALHLFHKMVSMNPLPCVNDFNFLFSSIVKMKHYTAAISLIKY 106 Query: 226 AHS 234 S Sbjct: 107 LFS 109 >KYP50144.1 Pentatricopeptide repeat-containing protein At1g62910 family [Cajanus cajan] Length = 519 Score = 74.7 bits (182), Expect = 6e-14 Identities = 36/61 (59%), Positives = 45/61 (73%) Frame = +1 Query: 52 RTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKTKRYTRAISLIKHAH 231 RT+LL SIR++ +VD A+ LFH+M AMKPFP KDFN L + +AK K YT ISL KH + Sbjct: 62 RTKLLVSIRNIRNVDTALDLFHQMIAMKPFPSNKDFNLLLSIIAKMKHYTTVISLTKHMY 121 Query: 232 S 234 S Sbjct: 122 S 122 >XP_015966106.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 587 Score = 73.2 bits (178), Expect = 2e-13 Identities = 36/75 (48%), Positives = 49/75 (65%) Frame = +1 Query: 10 THSNNNAVINDPRSRTQLLNSIRSLSDVDGAVTLFHEMAAMKPFPCVKDFNFLFTFVAKT 189 T S+ ++ + R L+NSIR+L ++D A+ LF +M +M P PCV DFNFL + + K Sbjct: 22 TLSHPKPFLDAIKDRPHLVNSIRNLQNLDSALHLFDKMVSMNPLPCVNDFNFLCSSIVKM 81 Query: 190 KRYTRAISLIKHAHS 234 K YT AISLIKH S Sbjct: 82 KHYTSAISLIKHLFS 96