BLASTX nr result
ID: Glycyrrhiza35_contig00027824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00027824 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJO61254.1 CenH3 [Vicia villosa] 55 4e-07 XP_019455729.1 PREDICTED: histone H3-like centromeric protein HT... 54 2e-06 XP_019455728.1 PREDICTED: histone H3-like centromeric protein HT... 54 2e-06 OIW14720.1 hypothetical protein TanjilG_33062, partial [Lupinus ... 51 7e-06 BAL42672.1 centromere specific histone H3 variant [Astragalus si... 52 7e-06 >AJO61254.1 CenH3 [Vicia villosa] Length = 134 Score = 55.1 bits (131), Expect = 4e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = -1 Query: 386 HAKRVTLMKKDFELARRLAGIGRPW*EHD---SSIEYHSC 276 HAKRVTLMKKD EL RRL GI RPW +HD +S E H C Sbjct: 95 HAKRVTLMKKDIELTRRLTGIARPWWKHDTVVTSSENHCC 134 >XP_019455729.1 PREDICTED: histone H3-like centromeric protein HTR12 isoform X2 [Lupinus angustifolius] Length = 145 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 386 HAKRVTLMKKDFELARRLAGIGRPW 312 HAKR+TLMKKDFELARRL GIGRPW Sbjct: 121 HAKRITLMKKDFELARRLGGIGRPW 145 >XP_019455728.1 PREDICTED: histone H3-like centromeric protein HTR12 isoform X1 [Lupinus angustifolius] OIW04633.1 hypothetical protein TanjilG_30531 [Lupinus angustifolius] Length = 148 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 386 HAKRVTLMKKDFELARRLAGIGRPW 312 HAKR+TLMKKDFELARRL GIGRPW Sbjct: 124 HAKRITLMKKDFELARRLGGIGRPW 148 >OIW14720.1 hypothetical protein TanjilG_33062, partial [Lupinus angustifolius] Length = 101 Score = 51.2 bits (121), Expect = 7e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -1 Query: 386 HAKRVTLMKKDFELARRLAGIGRPW 312 HAKRVTLMKKD ELARRL G+GRPW Sbjct: 77 HAKRVTLMKKDLELARRLGGVGRPW 101 >BAL42672.1 centromere specific histone H3 variant [Astragalus sinicus] Length = 122 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -1 Query: 386 HAKRVTLMKKDFELARRLAGIGRPW 312 HA+RVTL+KKDFELARRL GIGRPW Sbjct: 98 HARRVTLLKKDFELARRLGGIGRPW 122