BLASTX nr result
ID: Glycyrrhiza35_contig00027435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00027435 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007131989.1 hypothetical protein PHAVU_011G0575001g, partial ... 72 7e-15 XP_016169233.1 PREDICTED: LOB domain-containing protein 4-like [... 75 7e-15 XP_014518102.1 PREDICTED: LOB domain-containing protein 4-like [... 74 1e-14 XP_017435904.1 PREDICTED: LOB domain-containing protein 4-like [... 74 1e-14 BAT87661.1 hypothetical protein VIGAN_05105200 [Vigna angularis ... 74 1e-14 XP_003547318.1 PREDICTED: LOB domain-containing protein 4-like [... 74 1e-14 XP_003535054.1 PREDICTED: LOB domain-containing protein 4-like [... 74 1e-14 XP_019163400.1 PREDICTED: LOB domain-containing protein 4-like [... 73 3e-14 XP_006422217.1 hypothetical protein CICLE_v100061132mg, partial ... 70 3e-14 XP_010093051.1 hypothetical protein L484_016263 [Morus notabilis... 73 5e-14 XP_004294159.1 PREDICTED: LOB domain-containing protein 4 [Fraga... 73 5e-14 OAY30198.1 hypothetical protein MANES_14G012200 [Manihot esculenta] 72 6e-14 XP_019432352.1 PREDICTED: LOB domain-containing protein 4-like [... 72 8e-14 XP_016552419.1 PREDICTED: LOB domain-containing protein 4-like [... 72 1e-13 XP_015060787.1 PREDICTED: LOB domain-containing protein 4-like [... 72 1e-13 XP_004252871.1 PREDICTED: LOB domain-containing protein 4-like [... 72 1e-13 XP_019433853.1 PREDICTED: LOB domain-containing protein 4-like [... 71 2e-13 XP_008226099.1 PREDICTED: LOB domain-containing protein 4 [Prunu... 71 2e-13 XP_007212145.1 hypothetical protein PRUPE_ppa012253mg [Prunus pe... 71 2e-13 XP_012087393.1 PREDICTED: LOB domain-containing protein 4 [Jatro... 70 2e-13 >XP_007131989.1 hypothetical protein PHAVU_011G0575001g, partial [Phaseolus vulgaris] ESW03983.1 hypothetical protein PHAVU_011G0575001g, partial [Phaseolus vulgaris] Length = 60 Score = 72.0 bits (175), Expect = 7e-15 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKESGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_016169233.1 PREDICTED: LOB domain-containing protein 4-like [Arachis ipaensis] Length = 179 Score = 75.1 bits (183), Expect = 7e-15 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ AMSPCAACKLLRRRC +DCVFAPYFPA Sbjct: 1 MKEGGGRKQGAMSPCAACKLLRRRCAKDCVFAPYFPA 37 >XP_014518102.1 PREDICTED: LOB domain-containing protein 4-like [Vigna radiata var. radiata] Length = 164 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEGGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_017435904.1 PREDICTED: LOB domain-containing protein 4-like [Vigna angularis] KOM53190.1 hypothetical protein LR48_Vigan09g184900 [Vigna angularis] Length = 164 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEGGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >BAT87661.1 hypothetical protein VIGAN_05105200 [Vigna angularis var. angularis] Length = 166 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEGGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_003547318.1 PREDICTED: LOB domain-containing protein 4-like [Glycine max] KHN14353.1 LOB domain-containing protein 4 [Glycine soja] KRH11753.1 hypothetical protein GLYMA_15G127900 [Glycine max] Length = 170 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEGGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_003535054.1 PREDICTED: LOB domain-containing protein 4-like [Glycine max] KHN22979.1 LOB domain-containing protein 4 [Glycine soja] KRH36753.1 hypothetical protein GLYMA_09G021600 [Glycine max] Length = 170 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ A SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEGGGRKQGAASPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_019163400.1 PREDICTED: LOB domain-containing protein 4-like [Ipomoea nil] Length = 143 Score = 72.8 bits (177), Expect = 3e-14 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE +GRKQ +SPCAACKLLRRRC+QDCVFAPYFPA Sbjct: 1 MKESAGRKQSGVSPCAACKLLRRRCSQDCVFAPYFPA 37 >XP_006422217.1 hypothetical protein CICLE_v100061132mg, partial [Citrus clementina] ESR35457.1 hypothetical protein CICLE_v100061132mg, partial [Citrus clementina] Length = 61 Score = 70.5 bits (171), Expect = 3e-14 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 172 MMKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 +MKE SGRKQ A+SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 2 IMKE-SGRKQGALSPCAACKLLRRRCAQDCVFAPYFPA 38 >XP_010093051.1 hypothetical protein L484_016263 [Morus notabilis] EXB53379.1 hypothetical protein L484_016263 [Morus notabilis] Length = 171 Score = 72.8 bits (177), Expect = 5e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE GRKQ A+SPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKESGGRKQGAISPCAACKLLRRRCAQDCVFAPYFPA 37 >XP_004294159.1 PREDICTED: LOB domain-containing protein 4 [Fragaria vesca subsp. vesca] Length = 177 Score = 72.8 bits (177), Expect = 5e-14 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE SGRKQ MSPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEISGRKQGGMSPCAACKLLRRRCAQDCVFAPYFPA 37 >OAY30198.1 hypothetical protein MANES_14G012200 [Manihot esculenta] Length = 148 Score = 72.0 bits (175), Expect = 6e-14 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE SGRKQ A+SPCAACKLLRRRCTQDCVFAPYFPA Sbjct: 1 MKE-SGRKQGALSPCAACKLLRRRCTQDCVFAPYFPA 36 >XP_019432352.1 PREDICTED: LOB domain-containing protein 4-like [Lupinus angustifolius] Length = 164 Score = 72.0 bits (175), Expect = 8e-14 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ AMSPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKEG-GRKQGAMSPCAACKLLRRRCAQDCVFAPYFPA 36 >XP_016552419.1 PREDICTED: LOB domain-containing protein 4-like [Capsicum annuum] Length = 160 Score = 71.6 bits (174), Expect = 1e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE GRKQ A SPCAACKLLRRRCTQDCVF+PYFP+ Sbjct: 1 MKESGGRKQGATSPCAACKLLRRRCTQDCVFSPYFPS 37 >XP_015060787.1 PREDICTED: LOB domain-containing protein 4-like [Solanum pennellii] Length = 168 Score = 71.6 bits (174), Expect = 1e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE GRKQ A SPCAACKLLRRRCTQDCVF+PYFP+ Sbjct: 1 MKESGGRKQGATSPCAACKLLRRRCTQDCVFSPYFPS 37 >XP_004252871.1 PREDICTED: LOB domain-containing protein 4-like [Solanum lycopersicum] Length = 168 Score = 71.6 bits (174), Expect = 1e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE GRKQ A SPCAACKLLRRRCTQDCVF+PYFP+ Sbjct: 1 MKESGGRKQGATSPCAACKLLRRRCTQDCVFSPYFPS 37 >XP_019433853.1 PREDICTED: LOB domain-containing protein 4-like [Lupinus angustifolius] OIW21783.1 hypothetical protein TanjilG_10806 [Lupinus angustifolius] Length = 177 Score = 71.2 bits (173), Expect = 2e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKEG GRKQ AMSPCAACKLLRRRC +DCVFAPYFPA Sbjct: 1 MKEG-GRKQSAMSPCAACKLLRRRCAKDCVFAPYFPA 36 >XP_008226099.1 PREDICTED: LOB domain-containing protein 4 [Prunus mume] Length = 178 Score = 71.2 bits (173), Expect = 2e-13 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE SGRKQ AMSPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKE-SGRKQGAMSPCAACKLLRRRCAQDCVFAPYFPA 36 >XP_007212145.1 hypothetical protein PRUPE_ppa012253mg [Prunus persica] ONI11976.1 hypothetical protein PRUPE_4G138200 [Prunus persica] Length = 178 Score = 71.2 bits (173), Expect = 2e-13 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE SGRKQ AMSPCAACKLLRRRC QDCVFAPYFPA Sbjct: 1 MKE-SGRKQGAMSPCAACKLLRRRCAQDCVFAPYFPA 36 >XP_012087393.1 PREDICTED: LOB domain-containing protein 4 [Jatropha curcas] KDP25103.1 hypothetical protein JCGZ_22638 [Jatropha curcas] Length = 146 Score = 70.5 bits (171), Expect = 2e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 175 MKEGSGRKQCAMSPCAACKLLRRRCTQDCVFAPYFPA 285 MKE SGRKQ A+SPCAACKLLRRRC+QDCVFAPYFPA Sbjct: 1 MKE-SGRKQGALSPCAACKLLRRRCSQDCVFAPYFPA 36