BLASTX nr result
ID: Glycyrrhiza35_contig00027278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00027278 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024583595.1 MULTISPECIES: PEP-CTERM sorting domain-containing... 149 5e-44 >WP_024583595.1 MULTISPECIES: PEP-CTERM sorting domain-containing protein [Bradyrhizobium] KIU42862.1 hypothetical protein QU41_32295 [Bradyrhizobium elkanii] OCX31258.1 hypothetical protein QU42_10960 [Bradyrhizobium sp. UASWS1016] Length = 210 Score = 149 bits (377), Expect = 5e-44 Identities = 74/79 (93%), Positives = 75/79 (94%) Frame = -1 Query: 238 AGGSLYIEVSYQPGLAQWAGSTTSGDGISIILDGSTRSTSILPLGLSNYQVQPVVKQISF 59 AGGSLYIEVSYQPGLAQWAGST SGDGISIILDGSTRSTSI PL LSNYQVQPVVKQISF Sbjct: 75 AGGSLYIEVSYQPGLAQWAGSTASGDGISIILDGSTRSTSIFPLDLSNYQVQPVVKQISF 134 Query: 58 HAQADNGDIYSYAGSFSSL 2 HAQADNGDIYSYAG F+SL Sbjct: 135 HAQADNGDIYSYAGDFTSL 153