BLASTX nr result
ID: Glycyrrhiza35_contig00026443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00026443 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT73974.1 hypothetical protein VIGAN_01155100 [Vigna angularis ... 77 3e-13 XP_017412223.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 4e-13 XP_013457197.1 PPR containing plant-like protein [Medicago trunc... 75 1e-12 XP_012572465.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-12 KHN32569.1 Pentatricopeptide repeat-containing protein, mitochon... 74 3e-12 XP_003524064.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-12 XP_007159095.1 hypothetical protein PHAVU_002G208300g [Phaseolus... 73 6e-12 XP_014516252.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 8e-11 XP_019461403.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 8e-09 XP_016190621.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-08 XP_015957566.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-08 XP_004296694.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 9e-08 KYP61141.1 hypothetical protein KK1_023566 [Cajanus cajan] 60 1e-07 XP_010102179.1 hypothetical protein L484_024459 [Morus notabilis... 59 3e-07 XP_002522032.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 XP_008462724.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 XP_004142520.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 XP_018836849.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 KNA11241.1 hypothetical protein SOVF_136990 isoform B [Spinacia ... 57 2e-06 KNA11240.1 hypothetical protein SOVF_136990 isoform A [Spinacia ... 57 2e-06 >BAT73974.1 hypothetical protein VIGAN_01155100 [Vigna angularis var. angularis] Length = 459 Score = 76.6 bits (187), Expect = 3e-13 Identities = 39/65 (60%), Positives = 50/65 (76%) Frame = -2 Query: 195 NAMLLQAFAKLIILTSKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERT 16 NAML + +AKLI+ TSK L+++ H + T +S +DEYFA I HV+NIVRRDFY+ERT Sbjct: 10 NAML-KRYAKLILTTSKTLILNFHSFPKTLTTAASPRDEYFAVIHHVSNIVRRDFYLERT 68 Query: 15 LNKLR 1 LNKLR Sbjct: 69 LNKLR 73 >XP_017412223.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna angularis] XP_017412224.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna angularis] XP_017412225.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna angularis] XP_017412226.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna angularis] KOM31335.1 hypothetical protein LR48_Vigan01g089000 [Vigna angularis] Length = 448 Score = 76.3 bits (186), Expect = 4e-13 Identities = 36/62 (58%), Positives = 48/62 (77%) Frame = -2 Query: 186 LLQAFAKLIILTSKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERTLNK 7 +L+ +AKLI+ TSK L+++ H + T +S +DEYFA I HV+NIVRRDFY+ERTLNK Sbjct: 1 MLKRYAKLILTTSKTLILNFHSFPKTLTTAASPRDEYFAVIHHVSNIVRRDFYLERTLNK 60 Query: 6 LR 1 LR Sbjct: 61 LR 62 >XP_013457197.1 PPR containing plant-like protein [Medicago truncatula] KEH31228.1 PPR containing plant-like protein [Medicago truncatula] Length = 456 Score = 75.1 bits (183), Expect = 1e-12 Identities = 41/65 (63%), Positives = 50/65 (76%), Gaps = 3/65 (4%) Frame = -2 Query: 186 LLQAFAKLIILT---SKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERT 16 +L FAKLI T SK ++H H ++ T T+++KDEYFAAIQHVANIVRRDFY+ERT Sbjct: 1 MLHTFAKLIRTTTTLSKSKLLHHHK-TLTTTTTTTSKDEYFAAIQHVANIVRRDFYLERT 59 Query: 15 LNKLR 1 LNKLR Sbjct: 60 LNKLR 64 >XP_012572465.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Cicer arietinum] Length = 453 Score = 73.9 bits (180), Expect = 3e-12 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 5/67 (7%) Frame = -2 Query: 186 LLQAFAKLIILT---SKPLVVHPHLYSIRRTLTSS--AKDEYFAAIQHVANIVRRDFYME 22 +LQ FAKLI+ T KPL+ H +TLT++ +KDEYFAAIQHVANIVRRDFY+E Sbjct: 1 MLQTFAKLILNTLSKPKPLLHH------HKTLTTATTSKDEYFAAIQHVANIVRRDFYLE 54 Query: 21 RTLNKLR 1 RTLNKLR Sbjct: 55 RTLNKLR 61 >KHN32569.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 401 Score = 73.6 bits (179), Expect = 3e-12 Identities = 40/64 (62%), Positives = 52/64 (81%), Gaps = 2/64 (3%) Frame = -2 Query: 186 LLQAFAKLIILTSKPLVVHPHLYSIRRTLT--SSAKDEYFAAIQHVANIVRRDFYMERTL 13 +LQ +KLI+ SKP ++ +L+SI +TLT SS++DEYFA I HV+NIVRRDFY+ERTL Sbjct: 1 MLQTCSKLILRHSKPRLLL-NLHSITKTLTTASSSRDEYFAVIHHVSNIVRRDFYLERTL 59 Query: 12 NKLR 1 NKLR Sbjct: 60 NKLR 63 >XP_003524064.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Glycine max] XP_006579993.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Glycine max] XP_006579994.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Glycine max] KRH58282.1 hypothetical protein GLYMA_05G118000 [Glycine max] Length = 450 Score = 73.6 bits (179), Expect = 3e-12 Identities = 40/64 (62%), Positives = 52/64 (81%), Gaps = 2/64 (3%) Frame = -2 Query: 186 LLQAFAKLIILTSKPLVVHPHLYSIRRTLT--SSAKDEYFAAIQHVANIVRRDFYMERTL 13 +LQ +KLI+ SKP ++ +L+SI +TLT SS++DEYFA I HV+NIVRRDFY+ERTL Sbjct: 1 MLQTCSKLILRHSKPRLLL-NLHSITKTLTTASSSRDEYFAVIHHVSNIVRRDFYLERTL 59 Query: 12 NKLR 1 NKLR Sbjct: 60 NKLR 63 >XP_007159095.1 hypothetical protein PHAVU_002G208300g [Phaseolus vulgaris] ESW31089.1 hypothetical protein PHAVU_002G208300g [Phaseolus vulgaris] Length = 448 Score = 72.8 bits (177), Expect = 6e-12 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 2/64 (3%) Frame = -2 Query: 186 LLQAFAKLIILTSKPLVVHPHLYSIRRTLTS--SAKDEYFAAIQHVANIVRRDFYMERTL 13 +LQ +AKLI+ +K L+++ H SI +TLT+ SA+D+YFA I H++NIVRRDFY+ERTL Sbjct: 1 MLQNYAKLILTPTKTLLLNFH--SIPKTLTTAASARDQYFAVIHHISNIVRRDFYLERTL 58 Query: 12 NKLR 1 NKLR Sbjct: 59 NKLR 62 >XP_014516252.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna radiata var. radiata] XP_014516253.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna radiata var. radiata] XP_014516254.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna radiata var. radiata] XP_014516255.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna radiata var. radiata] XP_014516256.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vigna radiata var. radiata] Length = 455 Score = 69.7 bits (169), Expect = 8e-11 Identities = 38/65 (58%), Positives = 48/65 (73%) Frame = -2 Query: 195 NAMLLQAFAKLIILTSKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERT 16 NAML Q++AKL SK L+++ H + T +S +DEYFA I HV+NIVRRDFY+ERT Sbjct: 10 NAML-QSYAKL----SKTLLLNSHSFPKTLTTAASPRDEYFAVIHHVSNIVRRDFYLERT 64 Query: 15 LNKLR 1 LNKLR Sbjct: 65 LNKLR 69 >XP_019461403.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Lupinus angustifolius] OIW02107.1 hypothetical protein TanjilG_26647 [Lupinus angustifolius] Length = 457 Score = 63.9 bits (154), Expect = 8e-09 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 11/58 (18%) Frame = -2 Query: 141 LVVHPHLY-----SIRRTLTS------SAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 L++H HL+ S +TLT+ S +DEYFAAI HV+NIVRRDFYMERTLNKLR Sbjct: 10 LLLHHHLHRTNIPSTAKTLTTTTNTATSTRDEYFAAIHHVSNIVRRDFYMERTLNKLR 67 >XP_016190621.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] XP_016190624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] XP_016190625.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] Length = 457 Score = 61.6 bits (148), Expect = 5e-08 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = -2 Query: 201 VTNAMLLQAFAKLIILTSKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYME 22 +TN L + IL +K L T TSS +DEYF AI HV+NIVR+DFYME Sbjct: 2 LTNRATLIQLLRNSILNAKTLTT-------TATATSSNRDEYFTAIHHVSNIVRKDFYME 54 Query: 21 RTLNKLR 1 RTLNKLR Sbjct: 55 RTLNKLR 61 >XP_015957566.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis duranensis] Length = 457 Score = 61.6 bits (148), Expect = 5e-08 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = -2 Query: 201 VTNAMLLQAFAKLIILTSKPLVVHPHLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYME 22 +TN L + IL +K L T TSS +DEYF AI HV+NIVR+DFYME Sbjct: 2 LTNRATLIQLLRNSILNAKTLTT-------TATATSSNRDEYFTAIHHVSNIVRKDFYME 54 Query: 21 RTLNKLR 1 RTLNKLR Sbjct: 55 RTLNKLR 61 >XP_004296694.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] XP_011462575.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] XP_011462576.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] XP_011462577.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] XP_011462578.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] XP_011462579.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Fragaria vesca subsp. vesca] Length = 444 Score = 60.8 bits (146), Expect = 9e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 126 HLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 HL + R LT++ KD+YF+AI H+ NIVRRD +MERTLNKLR Sbjct: 14 HLLHLLRHLTTTTKDDYFSAIHHITNIVRRDHFMERTLNKLR 55 >KYP61141.1 hypothetical protein KK1_023566 [Cajanus cajan] Length = 409 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/38 (78%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -2 Query: 108 RTLTSSA--KDEYFAAIQHVANIVRRDFYMERTLNKLR 1 R+LTS+ +DEYFAAI HV+NIVRRDFYMERTLNKLR Sbjct: 15 RSLTSAGTPRDEYFAAIHHVSNIVRRDFYMERTLNKLR 52 >XP_010102179.1 hypothetical protein L484_024459 [Morus notabilis] EXB93122.1 hypothetical protein L484_024459 [Morus notabilis] Length = 470 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 105 TLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 T SS+KD YFAAI H++NIV+RDFYMERTLNKLR Sbjct: 46 TKPSSSKDNYFAAIHHISNIVQRDFYMERTLNKLR 80 >XP_002522032.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Ricinus communis] EEF40436.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 451 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -2 Query: 168 KLIIL--TSKPLVVHP--HLYSIRRTLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKL 4 KL IL T+ + + P HL + T T++ KD YFA I H+ NIVRRDFY ERTLNKL Sbjct: 6 KLFILPKTTATVTLQPLRHLKVLASTSTNNTKDAYFALIHHITNIVRRDFYPERTLNKL 64 >XP_008462724.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Cucumis melo] Length = 455 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 99 TSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 T+ +KD+YFAAI H+++IVRRDFYMERTLNKLR Sbjct: 34 TAPSKDDYFAAIHHISHIVRRDFYMERTLNKLR 66 >XP_004142520.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Cucumis sativus] KGN66807.1 hypothetical protein Csa_1G695420 [Cucumis sativus] Length = 455 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 99 TSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 T+ +KD+YFAAI H+++IVRRDFYMERTLNKLR Sbjct: 34 TAPSKDDYFAAIHHISHIVRRDFYMERTLNKLR 66 >XP_018836849.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Juglans regia] XP_018836850.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Juglans regia] XP_018836851.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Juglans regia] Length = 469 Score = 57.8 bits (138), Expect = 1e-06 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 15/70 (21%) Frame = -2 Query: 165 LIILTSKPLVVHPHL---YSIRRTLT------------SSAKDEYFAAIQHVANIVRRDF 31 L+ +S+P + P L +S +TLT S+ KD+YFAAI H++NIVRRDF Sbjct: 13 LLPASSRPQTLPPPLLLLFSTPKTLTTTNDAPPNDAVSSTTKDDYFAAIHHLSNIVRRDF 72 Query: 30 YMERTLNKLR 1 Y+ERTLNKL+ Sbjct: 73 YLERTLNKLQ 82 >KNA11241.1 hypothetical protein SOVF_136990 isoform B [Spinacia oleracea] Length = 651 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 105 TLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 T T++ DEYFAAI H++NIVRRD Y+ERTLNKLR Sbjct: 52 TTTTTTNDEYFAAIHHISNIVRRDIYLERTLNKLR 86 >KNA11240.1 hypothetical protein SOVF_136990 isoform A [Spinacia oleracea] Length = 679 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 105 TLTSSAKDEYFAAIQHVANIVRRDFYMERTLNKLR 1 T T++ DEYFAAI H++NIVRRD Y+ERTLNKLR Sbjct: 52 TTTTTTNDEYFAAIHHISNIVRRDIYLERTLNKLR 86