BLASTX nr result
ID: Glycyrrhiza35_contig00025799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025799 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAL45206.1 cytochrome P450 monooxygenase [Glycyrrhiza uralensis] 66 7e-11 XP_013464439.1 cytochrome P450 family 72 protein [Medicago trunc... 64 2e-10 XP_013464438.1 cytochrome P450 family 72 protein [Medicago trunc... 64 2e-10 XP_012567743.1 PREDICTED: cytochrome P450 CYP72A219-like isoform... 64 2e-10 XP_004488668.1 PREDICTED: cytochrome P450 CYP72A219-like isoform... 64 2e-10 XP_013464440.1 cytochrome P450 family 72 protein [Medicago trunc... 64 3e-10 CAA49445.1 cytochrome P-450, partial [Catharanthus roseus] 59 4e-10 KRH68375.1 hypothetical protein GLYMA_03G226800 [Glycine max] 64 4e-10 KHN14193.1 Secologanin synthase [Glycine soja] 64 4e-10 XP_004488665.1 PREDICTED: cytochrome P450 CYP72A219-like [Cicer ... 63 6e-10 XP_013464437.1 cytochrome P450 family protein [Medicago truncatu... 63 7e-10 KHN36820.1 Secologanin synthase [Glycine soja] 63 8e-10 KYP48920.1 Secologanin synthase [Cajanus cajan] 63 8e-10 XP_006594768.1 PREDICTED: cytochrome P450 CYP72A219-like [Glycin... 63 8e-10 ABC59099.1 cytochrome P450 monooxygenase CYP72A66, partial [Medi... 62 1e-09 XP_013464435.1 cytochrome P450 family monooxygenase [Medicago tr... 62 1e-09 XP_003546751.1 PREDICTED: cytochrome P450 CYP72A219-like [Glycin... 62 1e-09 XP_013464434.1 cytochrome P450 family 709 protein [Medicago trun... 62 1e-09 XP_013464445.1 cytochrome P450 family 72 protein [Medicago trunc... 59 2e-09 XP_003617766.1 cytochrome P450 family 72 protein [Medicago trunc... 62 2e-09 >BAL45206.1 cytochrome P450 monooxygenase [Glycyrrhiza uralensis] Length = 522 Score = 65.9 bits (159), Expect = 7e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSPAYAHAPTT+ITL+PQYGAHIILRKVE Sbjct: 490 SFELSPAYAHAPTTVITLRPQYGAHIILRKVE 521 >XP_013464439.1 cytochrome P450 family 72 protein [Medicago truncatula] KEH38474.1 cytochrome P450 family 72 protein [Medicago truncatula] Length = 305 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+YAHAP T+ITLQPQYGAHIILRKVE Sbjct: 273 SFELSPSYAHAPATVITLQPQYGAHIILRKVE 304 >XP_013464438.1 cytochrome P450 family 72 protein [Medicago truncatula] KEH38473.1 cytochrome P450 family 72 protein [Medicago truncatula] Length = 416 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+YAHAP T+ITLQPQYGAHIILRKVE Sbjct: 384 SFELSPSYAHAPATVITLQPQYGAHIILRKVE 415 >XP_012567743.1 PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Cicer arietinum] Length = 422 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+YAHAP T+ITLQPQYGAHIILRKVE Sbjct: 390 SFELSPSYAHAPATVITLQPQYGAHIILRKVE 421 >XP_004488668.1 PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Cicer arietinum] Length = 519 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+YAHAP T+ITLQPQYGAHIILRKVE Sbjct: 487 SFELSPSYAHAPATVITLQPQYGAHIILRKVE 518 >XP_013464440.1 cytochrome P450 family 72 protein [Medicago truncatula] KEH38475.1 cytochrome P450 family 72 protein [Medicago truncatula] Length = 518 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+YAHAPT +ITLQPQYGAHIILRKVE Sbjct: 486 SFELSPSYAHAPTALITLQPQYGAHIILRKVE 517 >CAA49445.1 cytochrome P-450, partial [Catharanthus roseus] Length = 54 Score = 58.9 bits (141), Expect = 4e-10 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKV 95 SFELSP+YAHAPT+I+TLQPQ+GAH+ILRK+ Sbjct: 24 SFELSPSYAHAPTSIVTLQPQHGAHLILRKL 54 >KRH68375.1 hypothetical protein GLYMA_03G226800 [Glycine max] Length = 501 Score = 63.5 bits (153), Expect = 4e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSPAYAHAP T+ TLQPQYGAH+ILRKVE Sbjct: 469 SFELSPAYAHAPVTVFTLQPQYGAHVILRKVE 500 >KHN14193.1 Secologanin synthase [Glycine soja] Length = 518 Score = 63.5 bits (153), Expect = 4e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSPAYAHAP T+ TLQPQYGAH+ILRKVE Sbjct: 486 SFELSPAYAHAPVTVFTLQPQYGAHVILRKVE 517 >XP_004488665.1 PREDICTED: cytochrome P450 CYP72A219-like [Cicer arietinum] Length = 524 Score = 63.2 bits (152), Expect = 6e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVET 101 SFELSP Y+HAPTT+ITL+PQ+GAHIILRKVET Sbjct: 492 SFELSPTYSHAPTTVITLRPQHGAHIILRKVET 524 >XP_013464437.1 cytochrome P450 family protein [Medicago truncatula] KEH38472.1 cytochrome P450 family protein [Medicago truncatula] Length = 353 Score = 62.8 bits (151), Expect = 7e-10 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 6 FELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 FELSP+YAHAP T+ITLQPQYGAHIILRKVE Sbjct: 322 FELSPSYAHAPATVITLQPQYGAHIILRKVE 352 >KHN36820.1 Secologanin synthase [Glycine soja] Length = 496 Score = 62.8 bits (151), Expect = 8e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSPAY HAP T+ITLQPQYGAH+ILRKVE Sbjct: 464 SFELSPAYTHAPFTVITLQPQYGAHVILRKVE 495 >KYP48920.1 Secologanin synthase [Cajanus cajan] Length = 516 Score = 62.8 bits (151), Expect = 8e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP+Y HAPTT+I+LQPQYGAH+ILRKVE Sbjct: 484 SFELSPSYTHAPTTVISLQPQYGAHVILRKVE 515 >XP_006594768.1 PREDICTED: cytochrome P450 CYP72A219-like [Glycine max] KRH22092.1 hypothetical protein GLYMA_13G277100 [Glycine max] Length = 523 Score = 62.8 bits (151), Expect = 8e-10 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSPAY HAP T+ITLQPQYGAH+ILRKVE Sbjct: 491 SFELSPAYTHAPFTVITLQPQYGAHVILRKVE 522 >ABC59099.1 cytochrome P450 monooxygenase CYP72A66, partial [Medicago truncatula] Length = 395 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVET 101 SFELS YAHAP+T+ITLQPQYGAHII+RKVET Sbjct: 363 SFELSSTYAHAPSTVITLQPQYGAHIIIRKVET 395 >XP_013464435.1 cytochrome P450 family monooxygenase [Medicago truncatula] KEH38470.1 cytochrome P450 family monooxygenase [Medicago truncatula] Length = 513 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVET 101 SFELS YAHAP+T+ITLQPQYGAHII+RKVET Sbjct: 481 SFELSSTYAHAPSTVITLQPQYGAHIIIRKVET 513 >XP_003546751.1 PREDICTED: cytochrome P450 CYP72A219-like [Glycine max] KRH13506.1 hypothetical protein GLYMA_15G244200 [Glycine max] Length = 520 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKV 95 SFELSPAYAHAPT +IT+QPQYGAHIILRKV Sbjct: 488 SFELSPAYAHAPTALITIQPQYGAHIILRKV 518 >XP_013464434.1 cytochrome P450 family 709 protein [Medicago truncatula] KEH38469.1 cytochrome P450 family 709 protein [Medicago truncatula] Length = 516 Score = 62.0 bits (149), Expect = 1e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVET 101 SFELSP YAHAP+++ITLQPQYGAHII+RK+ET Sbjct: 484 SFELSPTYAHAPSSMITLQPQYGAHIIIRKLET 516 >XP_013464445.1 cytochrome P450 family 72 protein [Medicago truncatula] KEH38480.1 cytochrome P450 family 72 protein [Medicago truncatula] Length = 143 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVE 98 SFELSP YAHAP ++ITL+PQ+GAHIILRKVE Sbjct: 111 SFELSPTYAHAPASVITLEPQHGAHIILRKVE 142 >XP_003617766.1 cytochrome P450 family 72 protein [Medicago truncatula] AET00725.1 cytochrome P450 family 72 protein [Medicago truncatula] Length = 516 Score = 61.6 bits (148), Expect = 2e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 SFELSPAYAHAPTTIITLQPQYGAHIILRKVET 101 SF+LSPAYAHAP T+I L+PQYGAHIILRK+ET Sbjct: 484 SFQLSPAYAHAPATVIALKPQYGAHIILRKLET 516