BLASTX nr result
ID: Glycyrrhiza35_contig00025599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025599 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014518926.1 PREDICTED: protein QUIRKY [Vigna radiata var. rad... 124 2e-30 XP_017437343.1 PREDICTED: protein QUIRKY [Vigna angularis] KOM51... 121 1e-29 BAT89039.1 hypothetical protein VIGAN_05271100 [Vigna angularis ... 121 1e-29 GAU27957.1 hypothetical protein TSUD_146750 [Trifolium subterran... 121 2e-29 XP_004489683.1 PREDICTED: protein QUIRKY [Cicer arietinum] 120 4e-29 XP_003542167.1 PREDICTED: protein QUIRKY [Glycine max] KRH17620.... 119 9e-29 XP_013451563.1 C2 domain first repeat protein [Medicago truncatu... 112 1e-28 XP_007145964.1 hypothetical protein PHAVU_006G001700g [Phaseolus... 115 3e-27 XP_016181298.1 PREDICTED: protein QUIRKY [Arachis ipaensis] 114 5e-27 XP_015947010.1 PREDICTED: protein QUIRKY [Arachis duranensis] 114 5e-27 XP_013451562.1 calcium-dependent lipid-binding (CaLB domain) fam... 114 7e-27 JAU90474.1 Ras GTPase-activating protein 4, partial [Noccaea cae... 103 4e-26 XP_019249824.1 PREDICTED: protein QUIRKY [Nicotiana attenuata] O... 111 6e-26 CDP10533.1 unnamed protein product [Coffea canephora] 109 2e-25 KVI00032.1 C2 calcium-dependent membrane targeting [Cynara cardu... 108 7e-25 XP_016471210.1 PREDICTED: protein QUIRKY-like [Nicotiana tabacum] 107 1e-24 XP_009757161.1 PREDICTED: uncharacterized protein LOC104210059 [... 107 1e-24 XP_016496212.1 PREDICTED: protein QUIRKY-like [Nicotiana tabacum] 107 1e-24 XP_009628258.1 PREDICTED: protein QUIRKY [Nicotiana tomentosifor... 107 1e-24 KZV36432.1 hypothetical protein F511_22187 [Dorcoceras hygrometr... 106 2e-24 >XP_014518926.1 PREDICTED: protein QUIRKY [Vigna radiata var. radiata] Length = 1016 Score = 124 bits (311), Expect = 2e-30 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEVVDAH+L PKDGHG+SSPYVVVDFYGQRRKTRTAVR+LNPVWNETLSFNV Sbjct: 1 MGTVRKLIVEVVDAHHLIPKDGHGSSSPYVVVDFYGQRRKTRTAVRDLNPVWNETLSFNV 60 Query: 28 DAH 20 D H Sbjct: 61 DTH 63 >XP_017437343.1 PREDICTED: protein QUIRKY [Vigna angularis] KOM51367.1 hypothetical protein LR48_Vigan09g002600 [Vigna angularis] Length = 1017 Score = 121 bits (304), Expect = 1e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKLIVE+VDAH+L PKDGHG+SSPYVVVDFYGQRRKTRTAVR+LNPVWNETLSFNV Sbjct: 1 MSTVRKLIVEIVDAHHLIPKDGHGSSSPYVVVDFYGQRRKTRTAVRDLNPVWNETLSFNV 60 Query: 28 DAH 20 D H Sbjct: 61 DTH 63 >BAT89039.1 hypothetical protein VIGAN_05271100 [Vigna angularis var. angularis] Length = 1058 Score = 121 bits (304), Expect = 1e-29 Identities = 56/63 (88%), Positives = 60/63 (95%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKLIVE+VDAH+L PKDGHG+SSPYVVVDFYGQRRKTRTAVR+LNPVWNETLSFNV Sbjct: 1 MSTVRKLIVEIVDAHHLIPKDGHGSSSPYVVVDFYGQRRKTRTAVRDLNPVWNETLSFNV 60 Query: 28 DAH 20 D H Sbjct: 61 DTH 63 >GAU27957.1 hypothetical protein TSUD_146750 [Trifolium subterraneum] Length = 996 Score = 121 bits (303), Expect = 2e-29 Identities = 55/63 (87%), Positives = 60/63 (95%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTV+KLIVEV+DA NLAPKDGHGTSSPY+V+DFYGQRRKTRTAVR+LNPVWNETLSFNV Sbjct: 1 MGTVKKLIVEVIDAQNLAPKDGHGTSSPYIVIDFYGQRRKTRTAVRDLNPVWNETLSFNV 60 Query: 28 DAH 20 H Sbjct: 61 GEH 63 >XP_004489683.1 PREDICTED: protein QUIRKY [Cicer arietinum] Length = 1022 Score = 120 bits (301), Expect = 4e-29 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGT+RKLIVEV+DA NLAPKDGHGTSSPY+VVDFYGQRRKTRTAVR+LNPVWNETLSFN Sbjct: 1 MGTIRKLIVEVIDAQNLAPKDGHGTSSPYIVVDFYGQRRKTRTAVRDLNPVWNETLSFNF 60 Query: 28 DAH 20 H Sbjct: 61 GEH 63 >XP_003542167.1 PREDICTED: protein QUIRKY [Glycine max] KRH17620.1 hypothetical protein GLYMA_13G003800 [Glycine max] Length = 1009 Score = 119 bits (298), Expect = 9e-29 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MG+VRKLIVEVVDAHNL PKDGHGTSSPYVVVDF+GQRRKTRTAVR+LNPVW ETLSFNV Sbjct: 1 MGSVRKLIVEVVDAHNLVPKDGHGTSSPYVVVDFHGQRRKTRTAVRDLNPVWKETLSFNV 60 Query: 28 D 26 D Sbjct: 61 D 61 >XP_013451563.1 C2 domain first repeat protein [Medicago truncatula] KEH25591.1 C2 domain first repeat protein [Medicago truncatula] Length = 212 Score = 112 bits (280), Expect = 1e-28 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKLIVEV+DA NLAPKDGHGTSS Y+VVDFYGQRRKTRT VR+LNPVWNETLSFNV Sbjct: 1 MATVRKLIVEVIDAQNLAPKDGHGTSSLYIVVDFYGQRRKTRTLVRDLNPVWNETLSFNV 60 >XP_007145964.1 hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris] ESW17958.1 hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris] Length = 1013 Score = 115 bits (287), Expect = 3e-27 Identities = 55/63 (87%), Positives = 57/63 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKLIVEVVDAH+L PKDGHG+SSPYVVVD YGQRRKTRTAVR LNPVWNE LSFNV Sbjct: 1 MATVRKLIVEVVDAHHLVPKDGHGSSSPYVVVDIYGQRRKTRTAVRGLNPVWNEKLSFNV 60 Query: 28 DAH 20 AH Sbjct: 61 HAH 63 >XP_016181298.1 PREDICTED: protein QUIRKY [Arachis ipaensis] Length = 1019 Score = 114 bits (285), Expect = 5e-27 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEVVDA NL PKDGHGTSSPYVV+DFYGQRRKT T +R+LNPVWNETLSFNV Sbjct: 1 MGTVRKLIVEVVDARNLLPKDGHGTSSPYVVIDFYGQRRKTHTVLRDLNPVWNETLSFNV 60 >XP_015947010.1 PREDICTED: protein QUIRKY [Arachis duranensis] Length = 1019 Score = 114 bits (285), Expect = 5e-27 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEVVDA NL PKDGHGTSSPYVV+DFYGQRRKT T +R+LNPVWNETLSFNV Sbjct: 1 MGTVRKLIVEVVDARNLLPKDGHGTSSPYVVIDFYGQRRKTHTVLRDLNPVWNETLSFNV 60 >XP_013451562.1 calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] KEH25590.1 calcium-dependent lipid-binding (CaLB domain) family protein [Medicago truncatula] Length = 1026 Score = 114 bits (284), Expect = 7e-27 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKLIVEV+DA NLAPKDGHGTSSPY+V+DF+GQRRKTRT VR+LNPVWNETLSFNV Sbjct: 1 MATVRKLIVEVIDAQNLAPKDGHGTSSPYIVIDFHGQRRKTRTLVRDLNPVWNETLSFNV 60 >JAU90474.1 Ras GTPase-activating protein 4, partial [Noccaea caerulescens] Length = 110 Score = 103 bits (256), Expect = 4e-26 Identities = 46/60 (76%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M T +KL+VEVVDA +L PKDGHGTSSPYVVVD+YGQRR+TRT VR+LNPVWNETL F++ Sbjct: 1 MATTKKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL 60 >XP_019249824.1 PREDICTED: protein QUIRKY [Nicotiana attenuata] OIT08359.1 protein quirky [Nicotiana attenuata] Length = 1029 Score = 111 bits (277), Expect = 6e-26 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEV+DA NL PKDGHGTSSPYVV DFYGQRRKTRT +R+LNP+WNE L FNV Sbjct: 1 MGTVRKLIVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRTVIRDLNPIWNEMLEFNV 60 >CDP10533.1 unnamed protein product [Coffea canephora] Length = 1067 Score = 109 bits (273), Expect = 2e-25 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEVVDA NL PKDGHGT SPYV++DFYGQR+KTRT +R+LNP WNETL FNV Sbjct: 1 MGTVRKLIVEVVDARNLPPKDGHGTCSPYVILDFYGQRKKTRTVIRDLNPAWNETLEFNV 60 >KVI00032.1 C2 calcium-dependent membrane targeting [Cynara cardunculus var. scolymus] Length = 1621 Score = 108 bits (269), Expect = 7e-25 Identities = 50/60 (83%), Positives = 52/60 (86%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M VRKLIVEVVDA NL PKDGHGTSSPYV+VDFYGQRRKTR R+LNPVWNETL FNV Sbjct: 1 MAAVRKLIVEVVDARNLVPKDGHGTSSPYVIVDFYGQRRKTRIVARDLNPVWNETLEFNV 60 >XP_016471210.1 PREDICTED: protein QUIRKY-like [Nicotiana tabacum] Length = 1029 Score = 107 bits (268), Expect = 1e-24 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEV+DA NL PKDGHGTSSPYVV DFYGQRRKTRT +R+L+PVWNE L F+V Sbjct: 1 MGTVRKLIVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRTVIRDLSPVWNEMLEFSV 60 >XP_009757161.1 PREDICTED: uncharacterized protein LOC104210059 [Nicotiana sylvestris] Length = 1029 Score = 107 bits (268), Expect = 1e-24 Identities = 49/60 (81%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKLIVEV+DA NL PKDGHGTSSPYVV DFYGQRRKTRT +R+L+PVWNE L F+V Sbjct: 1 MGTVRKLIVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRTVIRDLSPVWNEMLEFSV 60 >XP_016496212.1 PREDICTED: protein QUIRKY-like [Nicotiana tabacum] Length = 1029 Score = 107 bits (267), Expect = 1e-24 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKL+VEV+DA NL PKDGHGTSSPYVV DFYGQRRKTR +R+L+PVWNE L FNV Sbjct: 1 MGTVRKLVVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRAVIRDLSPVWNEMLEFNV 60 >XP_009628258.1 PREDICTED: protein QUIRKY [Nicotiana tomentosiformis] Length = 1029 Score = 107 bits (267), Expect = 1e-24 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 MGTVRKL+VEV+DA NL PKDGHGTSSPYVV DFYGQRRKTR +R+L+PVWNE L FNV Sbjct: 1 MGTVRKLVVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRAVIRDLSPVWNEMLEFNV 60 >KZV36432.1 hypothetical protein F511_22187 [Dorcoceras hygrometricum] Length = 1028 Score = 106 bits (265), Expect = 2e-24 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -2 Query: 208 MGTVRKLIVEVVDAHNLAPKDGHGTSSPYVVVDFYGQRRKTRTAVRELNPVWNETLSFNV 29 M TVRKL+VEVVDA NL PKDGHG SSPYVV+DF+GQRRKTRT +R+LNPVWN+TL FNV Sbjct: 1 MATVRKLVVEVVDARNLLPKDGHGASSPYVVLDFHGQRRKTRTMIRDLNPVWNDTLEFNV 60