BLASTX nr result
ID: Glycyrrhiza35_contig00025506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025506 (188 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP34413.1 Bromodomain and WD repeat-containing protein 1 [Cajan... 119 3e-31 XP_014618369.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 XP_014618367.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 XP_014618370.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 XP_019428466.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 OIV91006.1 hypothetical protein TanjilG_16966 [Lupinus angustifo... 120 4e-30 XP_006588570.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 XP_019428467.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 KRH31800.1 hypothetical protein GLYMA_10G013500 [Glycine max] KR... 120 4e-30 KHN30643.1 PH-interacting protein [Glycine soja] 120 4e-30 KRH31802.1 hypothetical protein GLYMA_10G013500 [Glycine max] 120 4e-30 XP_014618371.1 PREDICTED: bromodomain and WD repeat-containing p... 120 4e-30 KRH31803.1 hypothetical protein GLYMA_10G013500 [Glycine max] 120 4e-30 KRH31804.1 hypothetical protein GLYMA_10G013500 [Glycine max] 120 4e-30 XP_019452358.1 PREDICTED: bromodomain and WD repeat-containing p... 119 7e-30 XP_019452357.1 PREDICTED: bromodomain and WD repeat-containing p... 119 7e-30 XP_019452355.1 PREDICTED: bromodomain and WD repeat-containing p... 119 7e-30 XP_006574531.1 PREDICTED: bromodomain and WD repeat-containing p... 119 9e-30 XP_006574532.1 PREDICTED: bromodomain and WD repeat-containing p... 119 9e-30 XP_007145152.1 hypothetical protein PHAVU_007G214600g [Phaseolus... 115 1e-28 >KYP34413.1 Bromodomain and WD repeat-containing protein 1 [Cajanus cajan] Length = 321 Score = 119 bits (298), Expect = 3e-31 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS + GK+FKLTLPELI+F DFVVEKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 179 SCCKLKLRFVDPSSNMYGKSFKLTLPELINFPDFVVEKTWYDTAMKRNWSSRDKCMVWWR 238 Query: 181 NE 186 NE Sbjct: 239 NE 240 >XP_014618369.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X2 [Glycine max] Length = 1721 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1496 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1555 Query: 181 NE 186 NE Sbjct: 1556 NE 1557 >XP_014618367.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Glycine max] XP_014618368.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Glycine max] Length = 1722 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1496 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1555 Query: 181 NE 186 NE Sbjct: 1556 NE 1557 >XP_014618370.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X3 [Glycine max] Length = 1711 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1485 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1544 Query: 181 NE 186 NE Sbjct: 1545 NE 1546 >XP_019428466.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Lupinus angustifolius] Length = 1692 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK F+LTLPELI+F+DFVVEKTWYDTA+NRNWSSRDKC+VWWR Sbjct: 1467 SCCKLKLRFVDPSSHVHGKLFRLTLPELINFADFVVEKTWYDTAINRNWSSRDKCLVWWR 1526 Query: 181 NE 186 NE Sbjct: 1527 NE 1528 >OIV91006.1 hypothetical protein TanjilG_16966 [Lupinus angustifolius] Length = 1693 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK F+LTLPELI+F+DFVVEKTWYDTA+NRNWSSRDKC+VWWR Sbjct: 1468 SCCKLKLRFVDPSSHVHGKLFRLTLPELINFADFVVEKTWYDTAINRNWSSRDKCLVWWR 1527 Query: 181 NE 186 NE Sbjct: 1528 NE 1529 >XP_006588570.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X4 [Glycine max] Length = 1694 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1468 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1527 Query: 181 NE 186 NE Sbjct: 1528 NE 1529 >XP_019428467.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X2 [Lupinus angustifolius] Length = 1681 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK F+LTLPELI+F+DFVVEKTWYDTA+NRNWSSRDKC+VWWR Sbjct: 1456 SCCKLKLRFVDPSSHVHGKLFRLTLPELINFADFVVEKTWYDTAINRNWSSRDKCLVWWR 1515 Query: 181 NE 186 NE Sbjct: 1516 NE 1517 >KRH31800.1 hypothetical protein GLYMA_10G013500 [Glycine max] KRH31801.1 hypothetical protein GLYMA_10G013500 [Glycine max] Length = 1682 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1457 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1516 Query: 181 NE 186 NE Sbjct: 1517 NE 1518 >KHN30643.1 PH-interacting protein [Glycine soja] Length = 1683 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1457 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1516 Query: 181 NE 186 NE Sbjct: 1517 NE 1518 >KRH31802.1 hypothetical protein GLYMA_10G013500 [Glycine max] Length = 1549 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1324 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1383 Query: 181 NE 186 NE Sbjct: 1384 NE 1385 >XP_014618371.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X5 [Glycine max] Length = 1538 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1312 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1371 Query: 181 NE 186 NE Sbjct: 1372 NE 1373 >KRH31803.1 hypothetical protein GLYMA_10G013500 [Glycine max] Length = 1498 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1273 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1332 Query: 181 NE 186 NE Sbjct: 1333 NE 1334 >KRH31804.1 hypothetical protein GLYMA_10G013500 [Glycine max] Length = 1344 Score = 120 bits (300), Expect = 4e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1119 SCCKLKLRFVDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1178 Query: 181 NE 186 NE Sbjct: 1179 NE 1180 >XP_019452358.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X3 [Lupinus angustifolius] Length = 1349 Score = 119 bits (298), Expect = 7e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFVVEKTWYDTA+NRNWS RDKC+VWWR Sbjct: 1123 SCCKLKLRFVDPSSHVHGKSFKLTLPELINFADFVVEKTWYDTAVNRNWSLRDKCLVWWR 1182 Query: 181 NE 186 NE Sbjct: 1183 NE 1184 >XP_019452357.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X2 [Lupinus angustifolius] Length = 1649 Score = 119 bits (298), Expect = 7e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFVVEKTWYDTA+NRNWS RDKC+VWWR Sbjct: 1423 SCCKLKLRFVDPSSHVHGKSFKLTLPELINFADFVVEKTWYDTAVNRNWSLRDKCLVWWR 1482 Query: 181 NE 186 NE Sbjct: 1483 NE 1484 >XP_019452355.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Lupinus angustifolius] XP_019452356.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Lupinus angustifolius] OIW07030.1 hypothetical protein TanjilG_02664 [Lupinus angustifolius] Length = 1681 Score = 119 bits (298), Expect = 7e-30 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRFVD SS V GK+FKLTLPELI+F+DFVVEKTWYDTA+NRNWS RDKC+VWWR Sbjct: 1455 SCCKLKLRFVDPSSHVHGKSFKLTLPELINFADFVVEKTWYDTAVNRNWSLRDKCLVWWR 1514 Query: 181 NE 186 NE Sbjct: 1515 NE 1516 >XP_006574531.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X1 [Glycine max] KHN08641.1 Bromodomain and WD repeat-containing protein 1 [Glycine soja] Length = 1708 Score = 119 bits (297), Expect = 9e-30 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRF+D SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1482 SCCKLKLRFLDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1541 Query: 181 NE 186 NE Sbjct: 1542 NE 1543 >XP_006574532.1 PREDICTED: bromodomain and WD repeat-containing protein 3-like isoform X2 [Glycine max] KRH69223.1 hypothetical protein GLYMA_02G012900 [Glycine max] Length = 1707 Score = 119 bits (297), Expect = 9e-30 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKLRF+D SS V GK+FKLTLPELI+F+DFV+EKTWYDTA+ RNWSSRDKCMVWWR Sbjct: 1481 SCCKLKLRFLDPSSCVHGKSFKLTLPELINFTDFVIEKTWYDTAMKRNWSSRDKCMVWWR 1540 Query: 181 NE 186 NE Sbjct: 1541 NE 1542 >XP_007145152.1 hypothetical protein PHAVU_007G214600g [Phaseolus vulgaris] ESW17146.1 hypothetical protein PHAVU_007G214600g [Phaseolus vulgaris] Length = 1424 Score = 115 bits (288), Expect = 1e-28 Identities = 52/61 (85%), Positives = 55/61 (90%) Frame = +1 Query: 1 SCCKLKLRFVDRSSPVCGKAFKLTLPELIDFSDFVVEKTWYDTALNRNWSSRDKCMVWWR 180 SCCKLKL+FVD SS V GK FKLTLPELIDFS+FVVEKTWYDTA+ RNWSSRDKC VWWR Sbjct: 1196 SCCKLKLKFVDPSSFVHGKLFKLTLPELIDFSEFVVEKTWYDTAMKRNWSSRDKCKVWWR 1255 Query: 181 N 183 N Sbjct: 1256 N 1256