BLASTX nr result
ID: Glycyrrhiza35_contig00025488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025488 (847 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012570544.1 PREDICTED: pentatricopeptide repeat-containing pr... 168 8e-44 OIW01910.1 hypothetical protein TanjilG_15235 [Lupinus angustifo... 155 2e-39 XP_019462095.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 2e-39 XP_013466695.1 PPR containing plant-like protein [Medicago trunc... 155 3e-39 KYP37175.1 Pentatricopeptide repeat-containing protein At5g39710... 153 1e-38 XP_007153169.1 hypothetical protein PHAVU_003G012700g [Phaseolus... 148 1e-36 XP_014521304.1 PREDICTED: pentatricopeptide repeat-containing pr... 146 4e-36 XP_017427659.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 1e-35 XP_015947060.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 3e-35 XP_016181818.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 9e-35 XP_003556634.2 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-34 XP_006480134.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 4e-33 XP_018841966.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 7e-33 XP_006423060.1 hypothetical protein CICLE_v10028118mg [Citrus cl... 134 2e-32 KDO49128.1 hypothetical protein CISIN_1g004231mg [Citrus sinensi... 134 6e-32 OAY25426.1 hypothetical protein MANES_17G093600 [Manihot esculen... 132 3e-31 XP_010107974.1 hypothetical protein L484_027566 [Morus notabilis... 132 4e-31 XP_003631674.1 PREDICTED: pentatricopeptide repeat-containing pr... 131 7e-31 APO15854.1 pentatricopeptide repeat, partial [Sesuvium portulaca... 129 4e-30 XP_015874279.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 1e-29 >XP_012570544.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Cicer arietinum] XP_012570545.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Cicer arietinum] Length = 749 Score = 168 bits (425), Expect = 8e-44 Identities = 83/100 (83%), Positives = 89/100 (89%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 VRKAY MY EMV CGFV HMVTVIAL+KALS+EGM+DELSWVM+N+ SSCRL+DAELPKA Sbjct: 649 VRKAYDMYTEMVRCGFVSHMVTVIALVKALSKEGMNDELSWVMQNIFSSCRLNDAELPKA 708 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPASA 548 LVEIN KEGNMDAVLNVLTEMA DGLLPDGG YS A A A Sbjct: 709 LVEINFKEGNMDAVLNVLTEMASDGLLPDGGDYSCASAIA 748 >OIW01910.1 hypothetical protein TanjilG_15235 [Lupinus angustifolius] Length = 763 Score = 155 bits (393), Expect = 2e-39 Identities = 75/100 (75%), Positives = 87/100 (87%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++Y EM+HCGFV H VT+IALIK LSREGMDDEL+ V++N+L++CRL DAEL KA Sbjct: 664 VHKAYNLYKEMMHCGFVSHPVTIIALIKELSREGMDDELNQVVQNILTNCRLHDAELAKA 723 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPASA 548 LVE N +EGNMD VLN+LTEMAKDGLLPDG KYSYAP SA Sbjct: 724 LVENNFREGNMDTVLNILTEMAKDGLLPDGVKYSYAPTSA 763 >XP_019462095.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Lupinus angustifolius] XP_019462096.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Lupinus angustifolius] Length = 789 Score = 155 bits (393), Expect = 2e-39 Identities = 75/100 (75%), Positives = 87/100 (87%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++Y EM+HCGFV H VT+IALIK LSREGMDDEL+ V++N+L++CRL DAEL KA Sbjct: 690 VHKAYNLYKEMMHCGFVSHPVTIIALIKELSREGMDDELNQVVQNILTNCRLHDAELAKA 749 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPASA 548 LVE N +EGNMD VLN+LTEMAKDGLLPDG KYSYAP SA Sbjct: 750 LVENNFREGNMDTVLNILTEMAKDGLLPDGVKYSYAPTSA 789 >XP_013466695.1 PPR containing plant-like protein [Medicago truncatula] KEH40736.1 PPR containing plant-like protein [Medicago truncatula] Length = 745 Score = 155 bits (392), Expect = 3e-39 Identities = 78/100 (78%), Positives = 88/100 (88%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 VRKAY+MY EMVHCGFV HMVTVIALIKALS+EGM+DELS VM+N+L+SC L+DAEL KA Sbjct: 645 VRKAYNMYTEMVHCGFVSHMVTVIALIKALSKEGMNDELSSVMQNILNSCTLNDAELSKA 704 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPASA 548 LV IN KEG+MD VLN+LTEMA +GLLPDGG YS A ASA Sbjct: 705 LVRINFKEGHMDVVLNLLTEMANNGLLPDGGDYSCASASA 744 >KYP37175.1 Pentatricopeptide repeat-containing protein At5g39710 family, partial [Cajanus cajan] Length = 766 Score = 153 bits (387), Expect = 1e-38 Identities = 74/99 (74%), Positives = 86/99 (86%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++Y E+ CGFV H VTVIALIKAL+R+G+DDELS V++NVL SC+L+DAE+ K Sbjct: 667 VHKAYNLYTELERCGFVSHTVTVIALIKALARDGLDDELSRVLQNVLRSCKLNDAEVAKV 726 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 LVE+N KEGNMD VLNVLTEMAKDGLLPDGG YSYAPAS Sbjct: 727 LVEVNFKEGNMDGVLNVLTEMAKDGLLPDGGMYSYAPAS 765 >XP_007153169.1 hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] ESW25163.1 hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] Length = 767 Score = 148 bits (373), Expect = 1e-36 Identities = 73/99 (73%), Positives = 83/99 (83%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY MY E+ HCGFV H V VIAL+KALSREGM+DELS V++NVL SC+L+DAE+ K Sbjct: 668 VHKAYKMYTELEHCGFVSHTVAVIALVKALSREGMNDELSQVLQNVLRSCKLNDAEVAKV 727 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 LVE+N KEGNMDAVLNVLTEMAKDGLLPDGG +S A S Sbjct: 728 LVEVNFKEGNMDAVLNVLTEMAKDGLLPDGGMHSLALGS 766 >XP_014521304.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Vigna radiata var. radiata] Length = 771 Score = 146 bits (369), Expect = 4e-36 Identities = 71/99 (71%), Positives = 86/99 (86%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY+MY E+ H GFV H VTVIAL+KALSR+GM+DELS V++NVL SC+L+DAE+ K Sbjct: 672 VHKAYNMYTELEHYGFVSHTVTVIALVKALSRKGMNDELSQVLQNVLKSCKLNDAEVAKV 731 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 LVE+N KEGNMDAVLNVLT+MAKDGLLP+GG +S+AP S Sbjct: 732 LVEVNFKEGNMDAVLNVLTDMAKDGLLPNGGIHSFAPGS 770 >XP_017427659.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Vigna angularis] XP_017427660.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Vigna angularis] KOM46223.1 hypothetical protein LR48_Vigan06g152900 [Vigna angularis] BAT98818.1 hypothetical protein VIGAN_10016500 [Vigna angularis var. angularis] Length = 773 Score = 145 bits (366), Expect = 1e-35 Identities = 71/99 (71%), Positives = 84/99 (84%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY MY E+ H GFV H VTVIAL+KALSR+GM+DELS V++NV SC+L+DAE+ K Sbjct: 674 VHKAYKMYTELEHHGFVSHTVTVIALVKALSRKGMNDELSQVLRNVWRSCKLNDAEVAKV 733 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 LVE+N KEGNMDAVLNVLTEMAKDGLLP+GG +S+AP S Sbjct: 734 LVEVNFKEGNMDAVLNVLTEMAKDGLLPNGGMHSFAPGS 772 >XP_015947060.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis duranensis] Length = 760 Score = 144 bits (363), Expect = 3e-35 Identities = 70/99 (70%), Positives = 85/99 (85%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++Y EMV GFV H VTVIAL+KALS +GM+DE+S VM+NVL SCRLS+AEL K Sbjct: 661 VHKAYNLYKEMVRHGFVSHTVTVIALVKALSGKGMNDEVSQVMQNVLRSCRLSEAELAKV 720 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 L+EIN KEGNMDA +NVL +MAKDGLLPDGGK++Y+PA+ Sbjct: 721 LLEINFKEGNMDAAINVLVDMAKDGLLPDGGKFTYSPAT 759 >XP_016181818.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis ipaensis] XP_016181819.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis ipaensis] XP_016181820.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis ipaensis] XP_016181821.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis ipaensis] XP_016181822.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Arachis ipaensis] Length = 760 Score = 142 bits (359), Expect = 9e-35 Identities = 68/99 (68%), Positives = 85/99 (85%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++Y EMV GFV H VTVIAL+KALS +GM+DE+S VM+N+L SCRLS+AE+ K Sbjct: 661 VHKAYNLYKEMVRHGFVSHTVTVIALVKALSGKGMNDEVSQVMQNILRSCRLSEAEVAKV 720 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 L+EIN KEGNMDA +NVL +MAKDGLLPDGGK++Y+PA+ Sbjct: 721 LLEINFKEGNMDAAINVLVDMAKDGLLPDGGKFTYSPAT 759 >XP_003556634.2 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Glycine max] XP_006605469.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Glycine max] KRG89236.1 hypothetical protein GLYMA_20G010100 [Glycine max] Length = 778 Score = 142 bits (357), Expect = 2e-34 Identities = 69/99 (69%), Positives = 84/99 (84%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V KAY++YME+ H F H V VIAL+KAL+REGM+DELS +++N+L SCRL+DA++ K Sbjct: 679 VHKAYNLYMELEHSSFACHTVAVIALVKALAREGMNDELSRLLQNILRSCRLNDAKVAKV 738 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYAPAS 551 LVE+N KEGNMDAVLNVLTEMAKDGLLPDGG +S APAS Sbjct: 739 LVEVNFKEGNMDAVLNVLTEMAKDGLLPDGGIHSSAPAS 777 >XP_006480134.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Citrus sinensis] XP_015386406.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Citrus sinensis] Length = 766 Score = 138 bits (347), Expect = 4e-33 Identities = 67/95 (70%), Positives = 80/95 (84%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAY +Y +MVH GFVPH VT+I L+KAL R GM++ELS V++N+L SCRL+DAEL K Sbjct: 670 VQKAYDLYKKMVHSGFVPHTVTIIVLVKALHRAGMNEELSQVIENILRSCRLTDAELAKV 729 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSY 563 LVEIN KEGNMDAVLNVLTEMAKDGLLP+ G +Y Sbjct: 730 LVEINHKEGNMDAVLNVLTEMAKDGLLPNSGSSTY 764 >XP_018841966.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Juglans regia] XP_018841967.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Juglans regia] Length = 752 Score = 137 bits (345), Expect = 7e-33 Identities = 69/96 (71%), Positives = 82/96 (85%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAYS+Y +M++ GFVPH VT+IAL+KALS GM++ELS V+ NVL SCRL+DAEL K Sbjct: 655 VQKAYSLYKDMLNSGFVPHTVTIIALVKALSIGGMNEELSEVIGNVLRSCRLTDAELAKV 714 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYA 560 LVEIN KEGNMDAV NVLTEMAKDGLLP+ G+ SYA Sbjct: 715 LVEINQKEGNMDAVFNVLTEMAKDGLLPNSGRTSYA 750 >XP_006423060.1 hypothetical protein CICLE_v10028118mg [Citrus clementina] ESR36300.1 hypothetical protein CICLE_v10028118mg [Citrus clementina] Length = 557 Score = 134 bits (338), Expect = 2e-32 Identities = 66/95 (69%), Positives = 79/95 (83%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAY +Y +MV GFVPH VT+I L+KAL GM++ELS V++N+L SCRLSDAEL K Sbjct: 461 VQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKV 520 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSY 563 LVEIN KEGNMDAVLNVLTEMAKDGLLP+ G+ +Y Sbjct: 521 LVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTY 555 >KDO49128.1 hypothetical protein CISIN_1g004231mg [Citrus sinensis] KDO49129.1 hypothetical protein CISIN_1g004231mg [Citrus sinensis] Length = 766 Score = 134 bits (338), Expect = 6e-32 Identities = 66/95 (69%), Positives = 79/95 (83%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAY +Y +MV GFVPH VT+I L+KAL GM++ELS V++N+L SCRLSDAEL K Sbjct: 670 VQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKV 729 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSY 563 LVEIN KEGNMDAVLNVLTEMAKDGLLP+ G+ +Y Sbjct: 730 LVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTY 764 >OAY25426.1 hypothetical protein MANES_17G093600 [Manihot esculenta] OAY25427.1 hypothetical protein MANES_17G093600 [Manihot esculenta] Length = 756 Score = 132 bits (333), Expect = 3e-31 Identities = 63/91 (69%), Positives = 77/91 (84%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAY +Y EMVH GFVPH VT+IAL+K+L EGM++EL+ V++N+L SC+L+DAEL K Sbjct: 654 VQKAYKLYREMVHFGFVPHTVTIIALVKSLFSEGMNEELNQVVENILRSCKLTDAELAKV 713 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGG 575 LVEIN KEGNMD V NVLTEMAKDGL+P GG Sbjct: 714 LVEINHKEGNMDVVFNVLTEMAKDGLIPSGG 744 >XP_010107974.1 hypothetical protein L484_027566 [Morus notabilis] EXC17374.1 hypothetical protein L484_027566 [Morus notabilis] Length = 749 Score = 132 bits (332), Expect = 4e-31 Identities = 68/95 (71%), Positives = 78/95 (82%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 VRKAY +Y EM+ GFVPH VTVIALIKAL EGM+DELS V++N L SCRL+DAEL K Sbjct: 652 VRKAYYLYEEMMKFGFVPHTVTVIALIKALFTEGMNDELSHVIRNTLRSCRLTDAELAKV 711 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSY 563 LVEIN KEGNMDAV +VL+EMAKDGLLP+ G +Y Sbjct: 712 LVEINHKEGNMDAVFSVLSEMAKDGLLPNSGMTAY 746 >XP_003631674.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Vitis vinifera] Length = 762 Score = 131 bits (330), Expect = 7e-31 Identities = 64/94 (68%), Positives = 80/94 (85%) Frame = -1 Query: 841 KAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKALV 662 KA+++Y EM+H GFVPH VTVI LIKAL +EGM++E+S V+ + L SCRL++AEL K LV Sbjct: 667 KAFNLYKEMIHSGFVPHTVTVITLIKALFKEGMNEEMSEVIGDTLRSCRLNEAELAKVLV 726 Query: 661 EINLKEGNMDAVLNVLTEMAKDGLLPDGGKYSYA 560 EIN KEGNM+AVLNVLT+MAKDGLLP+ GK +YA Sbjct: 727 EINHKEGNMEAVLNVLTDMAKDGLLPNSGKTAYA 760 >APO15854.1 pentatricopeptide repeat, partial [Sesuvium portulacastrum] Length = 750 Score = 129 bits (324), Expect = 4e-30 Identities = 67/95 (70%), Positives = 77/95 (81%), Gaps = 1/95 (1%) Frame = -1 Query: 841 KAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKALV 662 KAY +Y EMVH GF+PH VTVIALIKAL R+ M+ EL V++NVL SC+LSDAEL K LV Sbjct: 656 KAYKLYKEMVHSGFIPHTVTVIALIKALFRKEMNKELGEVLENVLRSCKLSDAELAKVLV 715 Query: 661 EINLKEGNMDAVLNVLTEMAKDGLLPDGGK-YSYA 560 E+N KEGNMD+V NVLTEMAKDGLLP G+ SYA Sbjct: 716 EVNHKEGNMDSVFNVLTEMAKDGLLPRSGRNTSYA 750 >XP_015874279.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Ziziphus jujuba] Length = 751 Score = 128 bits (321), Expect = 1e-29 Identities = 64/92 (69%), Positives = 76/92 (82%) Frame = -1 Query: 847 VRKAYSMYMEMVHCGFVPHMVTVIALIKALSREGMDDELSWVMKNVLSSCRLSDAELPKA 668 V+KAY+ Y +MV+ GF+PH VTVIALIKAL EGM++ELS V+ N L SC+L+DAEL K Sbjct: 654 VQKAYNFYRDMVNFGFIPHTVTVIALIKALFNEGMNEELSTVIGNTLRSCQLTDAELAKV 713 Query: 667 LVEINLKEGNMDAVLNVLTEMAKDGLLPDGGK 572 LVEIN KEGNMDAV NVL +MAKDGLLP+ GK Sbjct: 714 LVEINHKEGNMDAVFNVLAQMAKDGLLPNSGK 745