BLASTX nr result
ID: Glycyrrhiza35_contig00025481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025481 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003608514.2 hypothetical protein MTR_4g096920 [Medicago trunc... 57 2e-07 AFK48307.1 unknown [Medicago truncatula] 55 3e-07 >XP_003608514.2 hypothetical protein MTR_4g096920 [Medicago truncatula] AES90711.2 hypothetical protein MTR_4g096920 [Medicago truncatula] Length = 147 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = -1 Query: 199 SGLGMTEVHEDSTMVSSDNILKSAPDVDLHNXXXXXXXXXXXXXGMDFTSIEDAKNYYTR 20 +G+ MT VH DS ++SSDNI++ AP+ D N G DF S EDAKNYYTR Sbjct: 2 TGVEMTNVHADSVLISSDNIVEIAPNADNSNGESQVEPSSEFYEGTDFASFEDAKNYYTR 61 >AFK48307.1 unknown [Medicago truncatula] Length = 93 Score = 55.5 bits (132), Expect = 3e-07 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = -1 Query: 187 MTEVHEDSTMVSSDNILKSAPDVDLHNXXXXXXXXXXXXXGMDFTSIEDAKNYYTR 20 MT VH DS ++SSDNI++ AP+ D N G DF S EDAKNYYTR Sbjct: 1 MTNVHADSVLISSDNIIEIAPNADNSNGESQVEPSSEFYEGTDFASFEDAKNYYTR 56