BLASTX nr result
ID: Glycyrrhiza35_contig00025454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025454 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35358.1 hypothetical protein TSUD_337500 [Trifolium subterran... 59 4e-08 EOY07655.1 RNA-binding family protein with retrovirus zinc finge... 40 2e-06 XP_016542632.1 PREDICTED: serine/arginine-rich splicing factor R... 53 4e-06 >GAU35358.1 hypothetical protein TSUD_337500 [Trifolium subterraneum] Length = 317 Score = 58.5 bits (140), Expect = 4e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 184 SVDFGDSFCNVIACFYGIGNNHKLV 110 SVDFGDSFCNVIACFYGIGNNHKLV Sbjct: 74 SVDFGDSFCNVIACFYGIGNNHKLV 98 >EOY07655.1 RNA-binding family protein with retrovirus zinc finger-like domain, putative [Theobroma cacao] Length = 312 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 23/35 (65%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = -1 Query: 278 FNRYGRFLGFWL--NPEVCGGRVALVELVEIPAEC 180 F+RYGRFLGF L P V G AL ELVEIPA+C Sbjct: 31 FSRYGRFLGFCLTWRPMVRGS--ALAELVEIPAQC 63 Score = 38.9 bits (89), Expect(2) = 2e-06 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 64 LSNDGLTVYGNHFRRVRDVDM 2 LSNDGLTV N+FRR+RDVDM Sbjct: 65 LSNDGLTVSSNNFRRIRDVDM 85 >XP_016542632.1 PREDICTED: serine/arginine-rich splicing factor RS2Z33-like isoform X1 [Capsicum annuum] Length = 338 Score = 53.1 bits (126), Expect = 4e-06 Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 2/61 (3%) Frame = -2 Query: 178 DFGDSFCNVIACFYGIG--NNHKLVFSSFFEGRSIIQFQ*LSNDGLTVYGNHFRRVRDVD 5 DFG F NV A FYGI +N +V EG+ +SNDGLTV GNHFRRVRDVD Sbjct: 12 DFGGPFYNVFAYFYGIPTISNWCIVH---LEGQIHELPVLISNDGLTVSGNHFRRVRDVD 68 Query: 4 M 2 M Sbjct: 69 M 69