BLASTX nr result
ID: Glycyrrhiza35_contig00025388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025388 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP41226.1 Putative pentatricopeptide repeat-containing protein ... 110 2e-26 XP_007158555.1 hypothetical protein PHAVU_002G162200g [Phaseolus... 106 2e-24 XP_003597616.1 PPR containing plant-like protein [Medicago trunc... 104 7e-24 GAU40843.1 hypothetical protein TSUD_111750 [Trifolium subterran... 104 7e-24 KHN32978.1 Putative pentatricopeptide repeat-containing protein ... 102 9e-24 XP_004486824.1 PREDICTED: putative pentatricopeptide repeat-cont... 103 2e-23 XP_016184029.1 PREDICTED: putative pentatricopeptide repeat-cont... 100 3e-22 XP_015950402.1 PREDICTED: putative pentatricopeptide repeat-cont... 100 3e-22 XP_014623061.1 PREDICTED: LOW QUALITY PROTEIN: putative pentatri... 99 4e-22 XP_019450035.1 PREDICTED: putative pentatricopeptide repeat-cont... 98 1e-21 XP_014499540.1 PREDICTED: putative pentatricopeptide repeat-cont... 98 2e-21 EEF52882.1 pentatricopeptide repeat-containing protein, putative... 93 3e-21 XP_017442755.1 PREDICTED: putative pentatricopeptide repeat-cont... 97 3e-21 XP_010523636.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 6e-21 XP_017981885.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 8e-21 EOY15303.1 Pentatricopeptide repeat (PPR) superfamily protein, p... 96 8e-21 XP_012073635.1 PREDICTED: putative pentatricopeptide repeat-cont... 96 8e-21 XP_008237970.1 PREDICTED: putative pentatricopeptide repeat-cont... 95 1e-20 XP_007210680.1 hypothetical protein PRUPE_ppa023340mg [Prunus pe... 95 1e-20 XP_014490864.1 PREDICTED: putative pentatricopeptide repeat-cont... 95 2e-20 >KYP41226.1 Putative pentatricopeptide repeat-containing protein At5g43820 family [Cajanus cajan] Length = 466 Score = 110 bits (276), Expect = 2e-26 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSNKLLASN+TERAYKLFLKIKHARSLENARNYWR NGWHF Sbjct: 414 KGFCPSRLVYSKLSNKLLASNKTERAYKLFLKIKHARSLENARNYWRANGWHF 466 >XP_007158555.1 hypothetical protein PHAVU_002G162200g [Phaseolus vulgaris] ESW30549.1 hypothetical protein PHAVU_002G162200g [Phaseolus vulgaris] Length = 549 Score = 106 bits (264), Expect = 2e-24 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSN+LLA+ +TERAYKLFLKIKHARSLENARNYWR NGWHF Sbjct: 497 KGFCPSRLVYSKLSNRLLATEKTERAYKLFLKIKHARSLENARNYWRSNGWHF 549 >XP_003597616.1 PPR containing plant-like protein [Medicago truncatula] ABN08410.1 Pentatricopeptide repeat [Medicago truncatula] AES67867.1 PPR containing plant-like protein [Medicago truncatula] Length = 527 Score = 104 bits (259), Expect = 7e-24 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSNKLLASN TERAY+LFLKIKHARSL+NAR+YWR NGWHF Sbjct: 475 KGFCPSRLVYSKLSNKLLASNLTERAYRLFLKIKHARSLKNARSYWRDNGWHF 527 >GAU40843.1 hypothetical protein TSUD_111750 [Trifolium subterraneum] Length = 539 Score = 104 bits (259), Expect = 7e-24 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSNKLLASN TERAY+LFLKIKHARSL+NAR+YWR NGWHF Sbjct: 487 KGFCPSRLVYSKLSNKLLASNLTERAYRLFLKIKHARSLKNARSYWRDNGWHF 539 >KHN32978.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 377 Score = 102 bits (255), Expect = 9e-24 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSN+LLAS+++ERAYKLFLKIKHARSLENA+ YWR NGWHF Sbjct: 325 KGFCPSRLVYSKLSNRLLASDKSERAYKLFLKIKHARSLENAKKYWRSNGWHF 377 >XP_004486824.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Cicer arietinum] XP_004486825.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Cicer arietinum] Length = 539 Score = 103 bits (256), Expect = 2e-23 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSNKLLAS++TERAY+LFLKIKHAR+L+NAR+YWR NGWHF Sbjct: 487 KGFCPSRLVYSKLSNKLLASDKTERAYRLFLKIKHARALKNARSYWRSNGWHF 539 >XP_016184029.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184034.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184043.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184051.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184059.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184065.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] XP_016184070.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis ipaensis] Length = 556 Score = 99.8 bits (247), Expect = 3e-22 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSN+LLASN+TE AYKLFLKIKHARSL++AR++WR NGWHF Sbjct: 504 KGFCPSRLVYSKLSNRLLASNKTEIAYKLFLKIKHARSLKSARSFWRSNGWHF 556 >XP_015950402.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Arachis duranensis] Length = 556 Score = 99.8 bits (247), Expect = 3e-22 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSN+LLASN+TE AYKLFLKIKHARSL++AR++WR NGWHF Sbjct: 504 KGFCPSRLVYSKLSNRLLASNKTEIAYKLFLKIKHARSLKSARSFWRSNGWHF 556 >XP_014623061.1 PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g43820 [Glycine max] Length = 504 Score = 99.4 bits (246), Expect = 4e-22 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSN+LLAS+++ERAYKLFLKIK ARSLENA+ YWR NGWHF Sbjct: 452 KGFCPSRLVYSKLSNRLLASDKSERAYKLFLKIKXARSLENAKKYWRSNGWHF 504 >XP_019450035.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Lupinus angustifolius] OIW07628.1 hypothetical protein TanjilG_16609 [Lupinus angustifolius] Length = 535 Score = 98.2 bits (243), Expect = 1e-21 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKLSNKLLASN+ E AY+LFLKI+HAR+L NAR YWR NGWHF Sbjct: 483 KGFCPSRLVYSKLSNKLLASNKEETAYRLFLKIRHARTLANARKYWRSNGWHF 535 >XP_014499540.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna radiata var. radiata] Length = 547 Score = 97.8 bits (242), Expect = 2e-21 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 K FCP RLVYSKLSN+LLA+ +TE AYKLFLKIKHARSLENARNYWR NGWHF Sbjct: 495 KRFCPRRLVYSKLSNRLLATKKTEIAYKLFLKIKHARSLENARNYWRGNGWHF 547 >EEF52882.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 195 Score = 92.8 bits (229), Expect = 3e-21 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRL+YSKL+NKLLAS++ ERAYKL+LK++ ARS ENAR +WR NGWHF Sbjct: 143 KGFCPSRLIYSKLNNKLLASSKVERAYKLYLKVRDARSNENARRFWRANGWHF 195 >XP_017442755.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442756.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442757.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442758.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442759.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442760.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] XP_017442761.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Vigna angularis] KOM24952.1 hypothetical protein LR48_Vigan27s002200 [Vigna angularis] BAT92873.1 hypothetical protein VIGAN_07172900 [Vigna angularis var. angularis] Length = 548 Score = 97.1 bits (240), Expect = 3e-21 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 K FCP RLV+SKLSN+LLA+ +TE AYKLFLKIKHARSLENARNYWR NGWHF Sbjct: 496 KRFCPRRLVFSKLSNRLLATKKTEMAYKLFLKIKHARSLENARNYWRGNGWHF 548 >XP_010523636.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Tarenaya hassleriana] XP_010523637.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Tarenaya hassleriana] XP_019056676.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Tarenaya hassleriana] Length = 560 Score = 96.3 bits (238), Expect = 6e-21 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCP+RLVYS+LSNKL+ASN+TE AYKLFLKIK AR ENAR YWR NGWHF Sbjct: 508 KGFCPNRLVYSRLSNKLMASNKTEMAYKLFLKIKEARGRENARRYWRSNGWHF 560 >XP_017981885.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_017981886.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_017981887.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_017981888.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_017981889.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_007018081.2 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] XP_017981890.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Theobroma cacao] Length = 562 Score = 95.9 bits (237), Expect = 8e-21 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSR++YSKL+NKLLASNE E+AYKLFLKIK+AR ENAR YWR NGWHF Sbjct: 510 KGFCPSRVLYSKLNNKLLASNEVEKAYKLFLKIKNARRDENARRYWRANGWHF 562 >EOY15303.1 Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] EOY15304.1 Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] EOY15305.1 Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] EOY15306.1 Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 562 Score = 95.9 bits (237), Expect = 8e-21 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSR++YSKL+NKLLASNE E+AYKLFLKIK+AR ENAR YWR NGWHF Sbjct: 510 KGFCPSRVLYSKLNNKLLASNEVEKAYKLFLKIKNARRDENARRYWRANGWHF 562 >XP_012073635.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Jatropha curcas] KDP36776.1 hypothetical protein JCGZ_08067 [Jatropha curcas] Length = 566 Score = 95.9 bits (237), Expect = 8e-21 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRL+YSKL NKLLASN+ ERAYKLFLKIK ARS ENAR +WR NGWHF Sbjct: 514 KGFCPSRLIYSKLYNKLLASNKVERAYKLFLKIKAARSNENARRFWRANGWHF 566 >XP_008237970.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Prunus mume] XP_016651167.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 [Prunus mume] Length = 562 Score = 95.1 bits (235), Expect = 1e-20 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKL+NKLLASN+ ERAYKLFLKIKHAR +NA+ +WR GWHF Sbjct: 510 KGFCPSRLVYSKLNNKLLASNKVERAYKLFLKIKHARRYDNAQRFWRSKGWHF 562 >XP_007210680.1 hypothetical protein PRUPE_ppa023340mg [Prunus persica] ONI05492.1 hypothetical protein PRUPE_5G009500 [Prunus persica] Length = 562 Score = 95.1 bits (235), Expect = 1e-20 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 KGFCPSRLVYSKL+NKLLASN+ ERAYKLFLKIKHAR +NA+ +WR GWHF Sbjct: 510 KGFCPSRLVYSKLNNKLLASNKVERAYKLFLKIKHARRYDNAQRFWRSKGWHF 562 >XP_014490864.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g43820 isoform X2 [Vigna radiata var. radiata] Length = 643 Score = 94.7 bits (234), Expect = 2e-20 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -2 Query: 338 KGFCPSRLVYSKLSNKLLASNETERAYKLFLKIKHARSLENARNYWRYNGWHF 180 K FCP RLVYSKLSN+LLA+ +TE AYKLFLKIKH RSLENAR YWR NGWHF Sbjct: 591 KRFCPRRLVYSKLSNRLLATKKTEMAYKLFLKIKHTRSLENARKYWRGNGWHF 643