BLASTX nr result
ID: Glycyrrhiza35_contig00025244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025244 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019432352.1 PREDICTED: LOB domain-containing protein 4-like [... 57 1e-07 OIW21128.1 hypothetical protein TanjilG_29784 [Lupinus angustifo... 57 5e-07 >XP_019432352.1 PREDICTED: LOB domain-containing protein 4-like [Lupinus angustifolius] Length = 164 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 135 HHHEQKPLASNSSSETKSLYAMDHMVVDEANMGESLWSC 251 H P+ASNSSS+TKS +AMD +VVD+ANMGESLWSC Sbjct: 127 HDQPPVPIASNSSSQTKSFFAMD-IVVDQANMGESLWSC 164 >OIW21128.1 hypothetical protein TanjilG_29784 [Lupinus angustifolius] Length = 640 Score = 56.6 bits (135), Expect = 5e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 135 HHHEQKPLASNSSSETKSLYAMDHMVVDEANMGESLWSC 251 H P+ASNSSS+TKS +AMD +VVD+ANMGESLWSC Sbjct: 603 HDQPPVPIASNSSSQTKSFFAMD-IVVDQANMGESLWSC 640