BLASTX nr result
ID: Glycyrrhiza35_contig00025177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025177 (239 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007162123.1 hypothetical protein PHAVU_001G125800g [Phaseolus... 53 2e-06 XP_014489713.1 PREDICTED: two-component response regulator ARR9 ... 53 2e-06 KRG95134.1 hypothetical protein GLYMA_19G132300 [Glycine max] 53 2e-06 XP_006603749.1 PREDICTED: uncharacterized protein LOC100814494 i... 53 2e-06 NP_001241095.1 uncharacterized protein LOC100814494 [Glycine max... 53 3e-06 KRG95133.1 hypothetical protein GLYMA_19G132300 [Glycine max] 53 3e-06 KHN14915.1 Two-component response regulator ARR9 [Glycine soja] 53 3e-06 XP_017416975.1 PREDICTED: two-component response regulator ARR9 ... 52 4e-06 NP_001240226.1 uncharacterized protein LOC100788079 [Glycine max... 52 5e-06 >XP_007162123.1 hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris] ESW34117.1 hypothetical protein PHAVU_001G125800g [Phaseolus vulgaris] Length = 241 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 207 SLQQ---ANNNKRKTMEQGLSPETDRTRPRYSGIAT 239 >XP_014489713.1 PREDICTED: two-component response regulator ARR9 [Vigna radiata var. radiata] Length = 243 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 209 SLQQ---ANNNKRKTMEQGLSPETDRTRPRYSGIAT 241 >KRG95134.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 214 Score = 52.8 bits (125), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 179 SLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 212 >XP_006603749.1 PREDICTED: uncharacterized protein LOC100814494 isoform X1 [Glycine max] KRG95132.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 220 Score = 52.8 bits (125), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 185 SLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 218 >NP_001241095.1 uncharacterized protein LOC100814494 [Glycine max] ACU24338.1 unknown [Glycine max] Length = 244 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 209 SLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 242 >KRG95133.1 hypothetical protein GLYMA_19G132300 [Glycine max] Length = 246 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 211 SLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 244 >KHN14915.1 Two-component response regulator ARR9 [Glycine soja] Length = 246 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N++KRKTME GLSPETDRTRPRYSG+ T Sbjct: 211 SLQQAN--NNSKRKTMEQGLSPETDRTRPRYSGIAT 244 >XP_017416975.1 PREDICTED: two-component response regulator ARR9 [Vigna angularis] KOM38705.1 hypothetical protein LR48_Vigan03g208700 [Vigna angularis] BAT85155.1 hypothetical protein VIGAN_04266000 [Vigna angularis var. angularis] Length = 243 Score = 52.4 bits (124), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 239 SLQQHAIINSTKRKTMEHGLSPETDRTRPRYSGMPT 132 SLQQ N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 208 SLQQAN--NNNKRKTMEQGLSPETDRTRPRYSGIAT 241 >NP_001240226.1 uncharacterized protein LOC100788079 [Glycine max] ACU21117.1 unknown [Glycine max] KHN30383.1 Two-component response regulator ARR9 [Glycine soja] KRH66808.1 hypothetical protein GLYMA_03G130000 [Glycine max] Length = 248 Score = 52.0 bits (123), Expect = 5e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -1 Query: 215 NSTKRKTMEHGLSPETDRTRPRYSGMPT 132 N+ KRKTME GLSPETDRTRPRYSG+ T Sbjct: 219 NNNKRKTMEQGLSPETDRTRPRYSGIAT 246