BLASTX nr result
ID: Glycyrrhiza35_contig00025079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00025079 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442827.1 transmembrane protein, putative [Medicago truncat... 72 3e-14 >XP_013442827.1 transmembrane protein, putative [Medicago truncatula] KEH16852.1 transmembrane protein, putative [Medicago truncatula] Length = 55 Score = 72.0 bits (175), Expect = 3e-14 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = +3 Query: 129 ERNCYSIRWARNNRKKPDLYGLSLNPYLICLIW*YPRLYQPTYVSPPSI 275 ERNCYSIRWARNNR KPDLYGLSLNPYLIC++ PTY+ SI Sbjct: 4 ERNCYSIRWARNNRNKPDLYGLSLNPYLICMLNMVIPPIVPTYICLSSI 52 Score = 51.2 bits (121), Expect = 3e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 191 SLFESLLNMLNMVIPPIVPTYICLSSINRY 280 SL L+ MLNMVIPPIVPTYICLSSINRY Sbjct: 26 SLNPYLICMLNMVIPPIVPTYICLSSINRY 55