BLASTX nr result
ID: Glycyrrhiza35_contig00024897
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024897 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OOF16960.1 hypothetical protein BZG79_05065 [Salinivibrio sp. MA... 57 5e-09 SJL85426.1 hypothetical protein VPAL9027_03480 [Vibrio sp. CECT ... 54 8e-08 CIN51991.1 Uncharacterised protein [Salmonella enterica subsp. e... 50 2e-06 KMG76845.1 hypothetical protein SM55_04735, partial [Klebsiella ... 49 4e-06 >OOF16960.1 hypothetical protein BZG79_05065 [Salinivibrio sp. MA427] Length = 75 Score = 57.0 bits (136), Expect = 5e-09 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 138 YGLESGRPKPDPLSLLRPPIALHDGTGMLTRFPSTTP 248 Y LE G+P P P SLLRPPIA+ TG+LTRFPSTTP Sbjct: 26 YTLEPGQPSPGPPSLLRPPIAVSSSTGILTRFPSTTP 62 >SJL85426.1 hypothetical protein VPAL9027_03480 [Vibrio sp. CECT 9027] Length = 75 Score = 53.9 bits (128), Expect = 8e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 138 YGLESGRPKPDPLSLLRPPIALHDGTGMLTRFPSTT 245 Y LE G+P P P SLLRPPIA+ TG+LTRFPSTT Sbjct: 26 YALEPGQPSPGPPSLLRPPIAIVRSTGILTRFPSTT 61 >CIN51991.1 Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhi] Length = 76 Score = 50.4 bits (119), Expect = 2e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +3 Query: 129 APGYGLESGRPKPDPLSLLRPPIALHDGTGMLTRFPSTT 245 +P Y L+ G+P P SLLRPPIA+ TG+LTRFPSTT Sbjct: 24 SPTYILKPGQPSPGQPSLLRPPIAIITSTGILTRFPSTT 62 >KMG76845.1 hypothetical protein SM55_04735, partial [Klebsiella pneumoniae] Length = 60 Score = 49.3 bits (116), Expect = 4e-06 Identities = 23/38 (60%), Positives = 26/38 (68%) Frame = +1 Query: 85 PRHHLSPLARRICLPRQATGLNRDVQNPTHLAFFVPPS 198 PRHH S L RICL Q T LNRD + P ++AF VPPS Sbjct: 22 PRHHTSALIIRICLDNQPTCLNRDNRRPANIAFSVPPS 59