BLASTX nr result
ID: Glycyrrhiza35_contig00024754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024754 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004506575.1 PREDICTED: mitochondrial import inner membrane tr... 54 2e-07 XP_013455000.1 import inner membrane translocase protein [Medica... 52 5e-07 >XP_004506575.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim9-like [Cicer arietinum] XP_004506576.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim9-like [Cicer arietinum] XP_012572929.1 PREDICTED: mitochondrial import inner membrane translocase subunit Tim9-like [Cicer arietinum] Length = 95 Score = 53.9 bits (128), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 169 MDKNIFGDLDNLPEEDKQRMSAIVNKLQTGD 261 MDKNIFG+LDNLP+EDKQRMS +V +LQT D Sbjct: 1 MDKNIFGELDNLPDEDKQRMSTMVEQLQTRD 31 >XP_013455000.1 import inner membrane translocase protein [Medicago truncatula] KEH29048.1 import inner membrane translocase protein [Medicago truncatula] Length = 78 Score = 52.4 bits (124), Expect = 5e-07 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 4/41 (9%) Frame = +1 Query: 169 MDKNIFGDLDNLPEEDKQRMSAIVNKLQTGD----RGSLTK 279 MDKNIFG++DNLPEEDK+RM+ +V +LQT D R SL K Sbjct: 1 MDKNIFGEVDNLPEEDKKRMTTMVEQLQTRDSSFYRSSLNK 41