BLASTX nr result
ID: Glycyrrhiza35_contig00024709
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024709 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU41979.1 hypothetical protein TSUD_306850, partial [Trifolium ... 55 2e-06 XP_004517225.2 PREDICTED: coiled-coil domain-containing protein ... 54 4e-06 XP_006578172.1 PREDICTED: uncharacterized protein LOC100790928 [... 52 6e-06 >GAU41979.1 hypothetical protein TSUD_306850, partial [Trifolium subterraneum] Length = 284 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 384 ERKIANDCDSESLTDGLHHSFSESLERVGLMKKGVQRHL 268 ERK+ +CD+ SLTDGLHHSFSE LERV LMKK + L Sbjct: 108 ERKLEYECDNNSLTDGLHHSFSERLERVDLMKKELAARL 146 >XP_004517225.2 PREDICTED: coiled-coil domain-containing protein 93-like [Cicer arietinum] Length = 284 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -3 Query: 384 ERKIANDC-DSESLTDGLHHSFSESLERVGLMKKGVQRHL 268 E KIAND DS+SLTDGLHHSFSESLERV LMKK + L Sbjct: 205 EIKIANDRNDSKSLTDGLHHSFSESLERVNLMKKELAARL 244 >XP_006578172.1 PREDICTED: uncharacterized protein LOC100790928 [Glycine max] KRH61840.1 hypothetical protein GLYMA_04G070700 [Glycine max] Length = 132 Score = 52.0 bits (123), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 384 ERKIANDCDSESLTDGLHHSFSESLERVGLMKK 286 ERKI NDCD+E+L D L+HSFSE +E+V LMKK Sbjct: 62 ERKITNDCDTENLPDELYHSFSELIEKVNLMKK 94