BLASTX nr result
ID: Glycyrrhiza35_contig00024638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024638 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016197697.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 5e-40 XP_004510607.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 6e-40 XP_015950719.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 2e-39 XP_015959229.1 PREDICTED: pentatricopeptide repeat-containing pr... 146 3e-39 KHN22949.1 Pentatricopeptide repeat-containing protein, chloropl... 140 8e-39 XP_016184237.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 1e-38 XP_016186147.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_014502411.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_014620508.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 XP_014502410.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 KHN18005.1 Pentatricopeptide repeat-containing protein, chloropl... 144 2e-38 XP_003539494.2 PREDICTED: pentatricopeptide repeat-containing pr... 144 2e-38 KOM40018.1 hypothetical protein LR48_Vigan04g021600 [Vigna angul... 144 2e-38 XP_017419933.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 3e-38 XP_018852740.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 OIW07641.1 hypothetical protein TanjilG_03749 [Lupinus angustifo... 142 6e-38 KRH75256.1 hypothetical protein GLYMA_01G073500 [Glycine max] 140 7e-38 XP_019450698.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 1e-37 XP_007138408.1 hypothetical protein PHAVU_009G206300g [Phaseolus... 141 2e-37 XP_003622527.1 PPR containing plant-like protein [Medicago trunc... 140 5e-37 >XP_016197697.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197699.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] XP_016197700.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] Length = 736 Score = 149 bits (375), Expect = 5e-40 Identities = 76/83 (91%), Positives = 80/83 (96%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK+SNG VKLEDRFFNSLIRSYGEAGLFKES+KLF+TMKSIGVSPS Sbjct: 148 RNLNVARNFLFSIEKKSNGEVKLEDRFFNSLIRSYGEAGLFKESIKLFETMKSIGVSPSV 207 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILLRRGRTNMA+ VY Sbjct: 208 VTFNSVLSILLRRGRTNMARAVY 230 >XP_004510607.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Cicer arietinum] Length = 740 Score = 148 bits (374), Expect = 6e-40 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 +NLNVARNFLFSIEKRSNG VKLEDRFFNSLIRSYGEAGLFKES+KLFQTMKSIGVSPS Sbjct: 135 KNLNVARNFLFSIEKRSNGEVKLEDRFFNSLIRSYGEAGLFKESIKLFQTMKSIGVSPSV 194 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 +TFNSVL ILLRRGRTNMAK+V+ Sbjct: 195 ITFNSVLLILLRRGRTNMAKEVF 217 >XP_015950719.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015950721.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] Length = 726 Score = 147 bits (370), Expect = 2e-39 Identities = 75/83 (90%), Positives = 79/83 (95%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK+SNG VKLEDRFFNSLIRSYGEAGLFKES+KLF+TMKS GVSPS Sbjct: 138 RNLNVARNFLFSIEKKSNGEVKLEDRFFNSLIRSYGEAGLFKESIKLFETMKSTGVSPSV 197 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILLRRGRTNMA+ VY Sbjct: 198 VTFNSVLSILLRRGRTNMARAVY 220 >XP_015959229.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015959230.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] XP_015959231.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis duranensis] Length = 735 Score = 146 bits (369), Expect = 3e-39 Identities = 75/83 (90%), Positives = 79/83 (95%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK+SNG VKLEDRFFNSLIRSYG AGLFKES+KLF+TMKSIGVSPS Sbjct: 148 RNLNVARNFLFSIEKKSNGEVKLEDRFFNSLIRSYGAAGLFKESIKLFETMKSIGVSPSV 207 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILLRRGRTNMA+ VY Sbjct: 208 VTFNSVLSILLRRGRTNMARAVY 230 >KHN22949.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Glycine soja] Length = 369 Score = 140 bits (354), Expect = 8e-39 Identities = 72/83 (86%), Positives = 76/83 (91%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK S G VKLEDRFFNSLIRSY EAGLFKESMKLFQTMKSI VSPS Sbjct: 31 RNLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSV 90 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFN++LSILL+RG TNMAK+VY Sbjct: 91 VTFNNLLSILLKRGCTNMAKEVY 113 >XP_016184237.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184238.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016184240.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184241.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016184242.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 725 Score = 144 bits (364), Expect = 1e-38 Identities = 74/83 (89%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK+SNG VKLEDRFFNSLIRSYGEAGLFKES+KLF+TMKS GV PS Sbjct: 138 RNLNVARNFLFSIEKKSNGEVKLEDRFFNSLIRSYGEAGLFKESIKLFETMKSTGVLPSV 197 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILLRRGRTNMA+ VY Sbjct: 198 VTFNSVLSILLRRGRTNMARAVY 220 >XP_016186147.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Arachis ipaensis] Length = 793 Score = 144 bits (364), Expect = 2e-38 Identities = 74/83 (89%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK+SNG VKLEDRFFNSLIRSYGEAGLFKES+KLF+TMKS GV PS Sbjct: 206 RNLNVARNFLFSIEKKSNGEVKLEDRFFNSLIRSYGEAGLFKESIKLFETMKSTGVLPSV 265 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILLRRGRTNMA+ VY Sbjct: 266 VTFNSVLSILLRRGRTNMARAVY 288 >XP_014502411.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X2 [Vigna radiata var. radiata] Length = 728 Score = 144 bits (363), Expect = 2e-38 Identities = 72/83 (86%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFSIEK+SNG VKLEDRFFN+LIRSY EAGLFKES+KLFQTMKS+ VSPS Sbjct: 123 RNLNVARNLLFSIEKKSNGTVKLEDRFFNTLIRSYAEAGLFKESLKLFQTMKSVAVSPSV 182 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILL+RGRTNMAK+VY Sbjct: 183 VTFNSVLSILLKRGRTNMAKEVY 205 >XP_014620508.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X2 [Glycine max] Length = 732 Score = 144 bits (363), Expect = 2e-38 Identities = 73/83 (87%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK S G VKLEDRFFNSLIRSY EAGLFKESMKLFQTMKSI VSPS Sbjct: 124 RNLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSV 183 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNS++SILL+RGRTNMAK+VY Sbjct: 184 VTFNSLMSILLKRGRTNMAKEVY 206 >XP_014502410.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like isoform X1 [Vigna radiata var. radiata] Length = 733 Score = 144 bits (363), Expect = 2e-38 Identities = 72/83 (86%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFSIEK+SNG VKLEDRFFN+LIRSY EAGLFKES+KLFQTMKS+ VSPS Sbjct: 128 RNLNVARNLLFSIEKKSNGTVKLEDRFFNTLIRSYAEAGLFKESLKLFQTMKSVAVSPSV 187 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILL+RGRTNMAK+VY Sbjct: 188 VTFNSVLSILLKRGRTNMAKEVY 210 >KHN18005.1 Pentatricopeptide repeat-containing protein, chloroplastic, partial [Glycine soja] Length = 662 Score = 144 bits (362), Expect = 2e-38 Identities = 73/83 (87%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK S G VKLEDRFFNSLIRSY EAGLFKESMKLFQTMKSI VSPS Sbjct: 49 RNLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSV 108 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFN++LSILL+RGRTNMAK+VY Sbjct: 109 VTFNNLLSILLKRGRTNMAKEVY 131 >XP_003539494.2 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X1 [Glycine max] XP_014620507.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic isoform X1 [Glycine max] KRH26747.1 hypothetical protein GLYMA_12G191600 [Glycine max] Length = 741 Score = 144 bits (363), Expect = 2e-38 Identities = 73/83 (87%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK S G VKLEDRFFNSLIRSY EAGLFKESMKLFQTMKSI VSPS Sbjct: 124 RNLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSV 183 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNS++SILL+RGRTNMAK+VY Sbjct: 184 VTFNSLMSILLKRGRTNMAKEVY 206 >KOM40018.1 hypothetical protein LR48_Vigan04g021600 [Vigna angularis] Length = 667 Score = 144 bits (362), Expect = 2e-38 Identities = 71/83 (85%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFSIEK+SNG VKLEDRFFN+LIRSY EAGLFKES+KLFQTMKS+ VSPS Sbjct: 70 RNLNVARNLLFSIEKKSNGTVKLEDRFFNTLIRSYAEAGLFKESLKLFQTMKSVAVSPSV 129 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 +TFNSVLSILL+RGRTNMAK+VY Sbjct: 130 ITFNSVLSILLKRGRTNMAKEVY 152 >XP_017419933.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic [Vigna angularis] BAT79845.1 hypothetical protein VIGAN_02278500 [Vigna angularis var. angularis] Length = 725 Score = 144 bits (362), Expect = 3e-38 Identities = 71/83 (85%), Positives = 78/83 (93%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFSIEK+SNG VKLEDRFFN+LIRSY EAGLFKES+KLFQTMKS+ VSPS Sbjct: 128 RNLNVARNLLFSIEKKSNGTVKLEDRFFNTLIRSYAEAGLFKESLKLFQTMKSVAVSPSV 187 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 +TFNSVLSILL+RGRTNMAK+VY Sbjct: 188 ITFNSVLSILLKRGRTNMAKEVY 210 >XP_018852740.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Juglans regia] Length = 1176 Score = 144 bits (362), Expect = 4e-38 Identities = 71/83 (85%), Positives = 79/83 (95%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFS+EKRSNGVVKLEDRFFNSLIR+YG AGLF+ES+KLF TMKS+GVSPS Sbjct: 142 RNLNVARNLLFSMEKRSNGVVKLEDRFFNSLIRNYGRAGLFQESIKLFTTMKSLGVSPSV 201 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNS+L+ILLRRGRTNMAKD+Y Sbjct: 202 VTFNSILTILLRRGRTNMAKDMY 224 >OIW07641.1 hypothetical protein TanjilG_03749 [Lupinus angustifolius] Length = 626 Score = 142 bits (358), Expect = 6e-38 Identities = 71/83 (85%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK SNGVVK+ED+FFNSLIRSYGEAGLFKESMKLFQ MKS+ VSPS Sbjct: 21 RNLNVARNFLFSIEKGSNGVVKVEDKFFNSLIRSYGEAGLFKESMKLFQIMKSVSVSPSV 80 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 +TFNS+L ILLRRGRT MAK+VY Sbjct: 81 ITFNSILLILLRRGRTTMAKEVY 103 >KRH75256.1 hypothetical protein GLYMA_01G073500 [Glycine max] Length = 502 Score = 140 bits (354), Expect = 7e-38 Identities = 72/83 (86%), Positives = 76/83 (91%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK S G VKLEDRFFNSLIRSY EAGLFKESMKLFQTMKSI VSPS Sbjct: 164 RNLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSV 223 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFN++LSILL+RG TNMAK+VY Sbjct: 224 VTFNNLLSILLKRGCTNMAKEVY 246 >XP_019450698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g02060, chloroplastic-like [Lupinus angustifolius] Length = 1141 Score = 142 bits (358), Expect = 1e-37 Identities = 71/83 (85%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARNFLFSIEK SNGVVK+ED+FFNSLIRSYGEAGLFKESMKLFQ MKS+ VSPS Sbjct: 135 RNLNVARNFLFSIEKGSNGVVKVEDKFFNSLIRSYGEAGLFKESMKLFQIMKSVSVSPSV 194 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 +TFNS+L ILLRRGRT MAK+VY Sbjct: 195 ITFNSILLILLRRGRTTMAKEVY 217 >XP_007138408.1 hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris] ESW10402.1 hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris] Length = 728 Score = 141 bits (356), Expect = 2e-37 Identities = 71/83 (85%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 RNLNVARN LFSIEK+SNG VKL DRFFN+LIRSY EAGLFKES+KLFQTMKS+ VSPS Sbjct: 123 RNLNVARNLLFSIEKKSNGTVKLGDRFFNTLIRSYAEAGLFKESLKLFQTMKSVAVSPSV 182 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVLSILL+RGRTNMAK+VY Sbjct: 183 VTFNSVLSILLKRGRTNMAKEVY 205 >XP_003622527.1 PPR containing plant-like protein [Medicago truncatula] AES78745.1 PPR containing plant-like protein [Medicago truncatula] Length = 721 Score = 140 bits (353), Expect = 5e-37 Identities = 69/83 (83%), Positives = 77/83 (92%) Frame = +2 Query: 2 RNLNVARNFLFSIEKRSNGVVKLEDRFFNSLIRSYGEAGLFKESMKLFQTMKSIGVSPSE 181 +NLN+ARNFL+SIEKRSNG VKLEDRFFNSLIRSYGEAGLFKES+KLF+ MK IGVSP Sbjct: 131 KNLNIARNFLYSIEKRSNGEVKLEDRFFNSLIRSYGEAGLFKESVKLFENMKLIGVSPGV 190 Query: 182 VTFNSVLSILLRRGRTNMAKDVY 250 VTFNSVL +LL+RGRTNMAK+VY Sbjct: 191 VTFNSVLLVLLKRGRTNMAKEVY 213