BLASTX nr result
ID: Glycyrrhiza35_contig00024517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024517 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CKZ49284.1 Uncharacterised protein [Mycobacterium tuberculosis] 70 1e-14 WP_076864299.1 branched-chain amino acid ABC transporter permeas... 75 3e-14 WP_050425474.1 branched-chain amino acid ABC transporter permeas... 75 3e-14 SED37506.1 amino acid/amide ABC transporter membrane protein 1, ... 75 3e-14 WP_050406245.1 branched-chain amino acid ABC transporter permeas... 75 3e-14 WP_050629570.1 branched-chain amino acid ABC transporter permeas... 75 3e-14 WP_024581720.1 MULTISPECIES: branched-chain amino acid ABC trans... 75 3e-14 ERF80190.1 branched-chain amino acid transport system permease [... 75 3e-14 SDE29712.1 amino acid/amide ABC transporter membrane protein 1, ... 74 7e-14 WP_069280360.1 ABC transporter permease [Bradyrhizobium elkanii]... 74 7e-14 WP_050382622.1 branched-chain amino acid ABC transporter permeas... 74 7e-14 WP_038384544.1 branched-chain amino acid ABC transporter permeas... 74 7e-14 WP_028336532.1 MULTISPECIES: branched-chain amino acid ABC trans... 74 7e-14 WP_016840939.1 branched-chain amino acid ABC transporter permeas... 74 7e-14 WP_074273026.1 branched-chain amino acid ABC transporter permeas... 72 2e-13 SEH50144.1 amino acid/amide ABC transporter membrane protein 1, ... 72 2e-13 SDN93494.1 amino acid/amide ABC transporter membrane protein 1, ... 72 2e-13 WP_074819788.1 branched-chain amino acid ABC transporter permeas... 72 2e-13 WP_065751331.1 branched-chain amino acid ABC transporter permeas... 72 2e-13 WP_065747525.1 branched-chain amino acid ABC transporter permeas... 72 2e-13 >CKZ49284.1 Uncharacterised protein [Mycobacterium tuberculosis] Length = 44 Score = 69.7 bits (169), Expect = 1e-14 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTL+LPVL+LRSLA+P+VEEE+D Sbjct: 7 AFSSFYASNFKEVIVFTLLLPVLILRSLASPEVEEEED 44 >WP_076864299.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium sp. SEMIA 6399] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >WP_050425474.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium sp. NAS96.2] OKO79950.1 ABC transporter permease [Bradyrhizobium sp. NAS96.2] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >SED37506.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium erythrophlei] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >WP_050406245.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium embrapense] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >WP_050629570.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium viridifuturi] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >WP_024581720.1 MULTISPECIES: branched-chain amino acid ABC transporter permease [Bradyrhizobium] KIU46792.1 ABC transporter permease [Bradyrhizobium elkanii] OCX29631.1 ABC transporter permease [Bradyrhizobium sp. UASWS1016] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >ERF80190.1 branched-chain amino acid transport system permease [Bradyrhizobium sp. DFCI-1] Length = 346 Score = 74.7 bits (182), Expect = 3e-14 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 346 >SDE29712.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium sp. R5] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_069280360.1 ABC transporter permease [Bradyrhizobium elkanii] ODM70828.1 ABC transporter permease [Bradyrhizobium elkanii] ODM80265.1 ABC transporter permease [Bradyrhizobium elkanii] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_050382622.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium pachyrhizi] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_038384544.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium elkanii] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_028336532.1 MULTISPECIES: branched-chain amino acid ABC transporter permease [Bradyrhizobium] KRQ10954.1 ABC transporter permease [Bradyrhizobium pachyrhizi] OMI02051.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium sp. UFLA 03-321] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_016840939.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium elkanii] OIM90750.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium elkanii] Length = 346 Score = 73.6 bits (179), Expect = 7e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >WP_074273026.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium erythrophlei] SIO20052.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium erythrophlei] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPAVEEEKD 346 >SEH50144.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Tardiphaga sp. OK245] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASN+KEVIVFTLILPVLVLRSLAAP+VEEEKD Sbjct: 309 AFSSFYASNYKEVIVFTLILPVLVLRSLAAPEVEEEKD 346 >SDN93494.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Afipia sp. GAS231] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPAVEEEKD 346 >WP_074819788.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium lablabi] SDJ04749.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium ottawaense] SEC98390.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium lablabi] SHL05412.1 amino acid/amide ABC transporter membrane protein 1, HAAT family [Bradyrhizobium lablabi] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPAVEEEKD 346 >WP_065751331.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium paxllaeri] OCK66267.1 ABC transporter permease [Bradyrhizobium paxllaeri] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPAVEEEKD 346 >WP_065747525.1 branched-chain amino acid ABC transporter permease [Bradyrhizobium sp. LMTR 3] OCK55775.1 ABC transporter permease [Bradyrhizobium sp. LMTR 3] Length = 346 Score = 72.4 bits (176), Expect = 2e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +1 Query: 1 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPQVEEEKD 114 AFSSFYASNFKEVIVFTLILPVLVLRSLAAP VEEEKD Sbjct: 309 AFSSFYASNFKEVIVFTLILPVLVLRSLAAPAVEEEKD 346