BLASTX nr result
ID: Glycyrrhiza35_contig00024378
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024378 (234 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003556454.1 PREDICTED: probable serine/threonine protein phos... 79 3e-15 XP_006589210.1 PREDICTED: probable serine/threonine protein phos... 78 4e-15 XP_004495571.1 PREDICTED: probable serine/threonine protein phos... 77 1e-14 XP_003590953.1 calcium-binding EF-hand protein [Medicago truncat... 77 1e-14 GAU21858.1 hypothetical protein TSUD_33540 [Trifolium subterraneum] 74 2e-14 KHN04952.1 Serine/threonine-protein phosphatase 2A regulatory su... 74 8e-14 KYP74535.1 Serine/threonine-protein phosphatase 2A regulatory su... 74 8e-14 XP_016175153.1 PREDICTED: probable serine/threonine protein phos... 74 2e-13 XP_015940299.1 PREDICTED: probable serine/threonine protein phos... 74 2e-13 GAU21856.1 hypothetical protein TSUD_33530 [Trifolium subterraneum] 74 2e-13 XP_007144012.1 hypothetical protein PHAVU_007G121700g [Phaseolus... 73 3e-13 XP_014513292.1 PREDICTED: probable serine/threonine protein phos... 73 3e-13 XP_019452924.1 PREDICTED: serine/threonine protein phosphatase 2... 70 4e-12 XP_007147220.1 hypothetical protein PHAVU_006G105800g [Phaseolus... 69 5e-12 KHN43157.1 hypothetical protein glysoja_001740 [Glycine soja] 66 9e-12 XP_017439821.1 PREDICTED: probable serine/threonine protein phos... 68 1e-11 XP_014491578.1 PREDICTED: probable serine/threonine protein phos... 68 1e-11 KOM55681.1 hypothetical protein LR48_Vigan10g157300 [Vigna angul... 68 1e-11 KRG97048.1 hypothetical protein GLYMA_19G2486002, partial [Glyci... 66 1e-11 XP_017410973.1 PREDICTED: serine/threonine protein phosphatase 2... 67 2e-11 >XP_003556454.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Glycine max] XP_006606445.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Glycine max] XP_006606446.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Glycine max] KRG92625.1 hypothetical protein GLYMA_20G222700 [Glycine max] KRG92626.1 hypothetical protein GLYMA_20G222700 [Glycine max] KRG92627.1 hypothetical protein GLYMA_20G222700 [Glycine max] Length = 537 Score = 78.6 bits (192), Expect = 3e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MNMEVVTDAASLDVELLQLPEFS LALKSNLNF+EKLF QW Sbjct: 1 MNMEVVTDAASLDVELLQLPEFSGLALKSNLNFIEKLFNQW 41 >XP_006589210.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Glycine max] XP_006589211.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Glycine max] XP_006589212.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Glycine max] KHN14813.1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Glycine soja] KRH34156.1 hypothetical protein GLYMA_10G166500 [Glycine max] Length = 537 Score = 78.2 bits (191), Expect = 4e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MNMEVVTDAASLD+ELLQLPEFS LALKSNLNF+EKLF+QW Sbjct: 1 MNMEVVTDAASLDLELLQLPEFSGLALKSNLNFIEKLFDQW 41 >XP_004495571.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Cicer arietinum] Length = 537 Score = 76.6 bits (187), Expect = 1e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVVTDAASLDVELLQLPEFS L+LK+NLNFVEKLFEQW Sbjct: 1 MSMEVVTDAASLDVELLQLPEFSTLSLKTNLNFVEKLFEQW 41 >XP_003590953.1 calcium-binding EF-hand protein [Medicago truncatula] AES61204.1 calcium-binding EF-hand protein [Medicago truncatula] Length = 537 Score = 76.6 bits (187), Expect = 1e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVVTDAASLDVELLQLPEFS L+LK+NLNFVEKLFEQW Sbjct: 1 MSMEVVTDAASLDVELLQLPEFSTLSLKANLNFVEKLFEQW 41 >GAU21858.1 hypothetical protein TSUD_33540 [Trifolium subterraneum] Length = 197 Score = 73.6 bits (179), Expect = 2e-14 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 121 EVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 EVVTDAASLDVELLQLPEFS LALK+NLNFVEKLFEQW Sbjct: 3 EVVTDAASLDVELLQLPEFSTLALKTNLNFVEKLFEQW 40 >KHN04952.1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Glycine soja] Length = 535 Score = 74.3 bits (181), Expect = 8e-14 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 118 MEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MEVVTDAASLDVELLQLPEFS LALKSNLNF+EKLF QW Sbjct: 1 MEVVTDAASLDVELLQLPEFSGLALKSNLNFIEKLFNQW 39 >KYP74535.1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Cajanus cajan] Length = 537 Score = 74.3 bits (181), Expect = 8e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MNM+VVTD ASLDVELLQLPEFS LALKSN NFVEKLF+QW Sbjct: 1 MNMDVVTDVASLDVELLQLPEFSGLALKSNHNFVEKLFDQW 41 >XP_016175153.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Arachis ipaensis] Length = 537 Score = 73.6 bits (179), Expect = 2e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV DAASLDVELLQLPE S LALKSNLNFVEKLF+QW Sbjct: 1 MSMEVVVDAASLDVELLQLPELSGLALKSNLNFVEKLFDQW 41 >XP_015940299.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Arachis duranensis] Length = 537 Score = 73.6 bits (179), Expect = 2e-13 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV DAASLDVELLQLPE S LALKSNLNFVEKLF+QW Sbjct: 1 MSMEVVVDAASLDVELLQLPELSGLALKSNLNFVEKLFDQW 41 >GAU21856.1 hypothetical protein TSUD_33530 [Trifolium subterraneum] Length = 550 Score = 73.6 bits (179), Expect = 2e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 121 EVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 EVVTDAASLDVELLQLPEFS LALK+NLNFVEKLFEQW Sbjct: 3 EVVTDAASLDVELLQLPEFSTLALKTNLNFVEKLFEQW 40 >XP_007144012.1 hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] XP_007144013.1 hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] ESW16006.1 hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] ESW16007.1 hypothetical protein PHAVU_007G121700g [Phaseolus vulgaris] Length = 535 Score = 72.8 bits (177), Expect = 3e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MNMEVVTDAASLDVELLQLP+F ALALK+N NF++KLF+QW Sbjct: 1 MNMEVVTDAASLDVELLQLPDFPALALKANNNFIQKLFDQW 41 >XP_014513292.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Vigna radiata var. radiata] XP_014513293.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Vigna radiata var. radiata] XP_014513294.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta isoform X1 [Vigna radiata var. radiata] Length = 536 Score = 72.8 bits (177), Expect = 3e-13 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MNMEVVTD ASLDVELL LP+FSALALKSN NF+EKLF+QW Sbjct: 1 MNMEVVTDVASLDVELLLLPDFSALALKSNHNFIEKLFDQW 41 >XP_019452924.1 PREDICTED: serine/threonine protein phosphatase 2A regulatory subunit B''beta-like [Lupinus angustifolius] XP_019452925.1 PREDICTED: serine/threonine protein phosphatase 2A regulatory subunit B''beta-like [Lupinus angustifolius] OIW07169.1 hypothetical protein TanjilG_10142 [Lupinus angustifolius] Length = 535 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 118 MEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 MEVVTDAAS D ELLQLPEFS+ A+KSNLNFVEKLF+QW Sbjct: 1 MEVVTDAASFDAELLQLPEFSSSAIKSNLNFVEKLFDQW 39 >XP_007147220.1 hypothetical protein PHAVU_006G105800g [Phaseolus vulgaris] ESW19214.1 hypothetical protein PHAVU_006G105800g [Phaseolus vulgaris] Length = 537 Score = 69.3 bits (168), Expect = 5e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV+D ASLDVELLQLPE S+LALKSNL+FVE LFEQW Sbjct: 1 MSMEVVSDTASLDVELLQLPEVSSLALKSNLSFVETLFEQW 41 >KHN43157.1 hypothetical protein glysoja_001740 [Glycine soja] Length = 171 Score = 66.2 bits (160), Expect = 9e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV D ASL+V+LLQLPE SALALKSNL FVE LFEQW Sbjct: 1 MSMEVVGDTASLEVDLLQLPEVSALALKSNLTFVETLFEQW 41 >XP_017439821.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna angularis] XP_017439822.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna angularis] XP_017439823.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna angularis] XP_017439824.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna angularis] BAT87920.1 hypothetical protein VIGAN_05134300 [Vigna angularis var. angularis] Length = 537 Score = 68.2 bits (165), Expect = 1e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV+D ASLDV+LLQLPE S+LALKSNL+FVE LFEQW Sbjct: 1 MSMEVVSDTASLDVDLLQLPEVSSLALKSNLSFVETLFEQW 41 >XP_014491578.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna radiata var. radiata] XP_014491579.1 PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''delta [Vigna radiata var. radiata] Length = 537 Score = 68.2 bits (165), Expect = 1e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV+D ASLDV+LLQLPE S+LALKSNL+FVE LFEQW Sbjct: 1 MSMEVVSDTASLDVDLLQLPEVSSLALKSNLSFVETLFEQW 41 >KOM55681.1 hypothetical protein LR48_Vigan10g157300 [Vigna angularis] Length = 567 Score = 68.2 bits (165), Expect = 1e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV+D ASLDV+LLQLPE S+LALKSNL+FVE LFEQW Sbjct: 1 MSMEVVSDTASLDVDLLQLPEVSSLALKSNLSFVETLFEQW 41 >KRG97048.1 hypothetical protein GLYMA_19G2486002, partial [Glycine max] Length = 197 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 112 MNMEVVTDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M+MEVV D ASL+V+LLQLPE SALALKSNL FVE LFEQW Sbjct: 1 MSMEVVGDTASLEVDLLQLPEVSALALKSNLTFVETLFEQW 41 >XP_017410973.1 PREDICTED: serine/threonine protein phosphatase 2A regulatory subunit B''beta isoform X1 [Vigna angularis] XP_017410974.1 PREDICTED: serine/threonine protein phosphatase 2A regulatory subunit B''beta isoform X1 [Vigna angularis] XP_017410975.1 PREDICTED: serine/threonine protein phosphatase 2A regulatory subunit B''beta isoform X1 [Vigna angularis] BAT94930.1 hypothetical protein VIGAN_08158200 [Vigna angularis var. angularis] Length = 537 Score = 67.4 bits (163), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +1 Query: 112 MNMEVV-TDAASLDVELLQLPEFSALALKSNLNFVEKLFEQW 234 M MEVV TDAASLDVELL LP+FSALALKSN NF+EKLF+QW Sbjct: 1 MKMEVVVTDAASLDVELLLLPDFSALALKSNHNFIEKLFDQW 42