BLASTX nr result
ID: Glycyrrhiza35_contig00024329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00024329 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016204826.1 PREDICTED: pentatricopeptide repeat-containing pr... 161 6e-44 XP_015958293.1 PREDICTED: pentatricopeptide repeat-containing pr... 160 1e-43 XP_016197079.1 PREDICTED: pentatricopeptide repeat-containing pr... 158 6e-43 XP_015969806.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 8e-42 XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 3e-41 XP_004512505.1 PREDICTED: pentatricopeptide repeat-containing pr... 151 2e-40 OIV97404.1 hypothetical protein TanjilG_16165 [Lupinus angustifo... 150 2e-40 XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 5e-40 GAU41461.1 hypothetical protein TSUD_237110 [Trifolium subterran... 145 2e-38 GAU13143.1 hypothetical protein TSUD_112040 [Trifolium subterran... 144 3e-38 KHN04861.1 Pentatricopeptide repeat-containing protein, mitochon... 143 7e-38 XP_017426117.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 8e-38 XP_014519698.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 3e-37 KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] 141 7e-37 XP_003612846.2 PPR containing plant-like protein [Medicago trunc... 140 2e-36 KDP35484.1 hypothetical protein JCGZ_10931 [Jatropha curcas] 137 2e-36 XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 5e-36 EOY25154.1 Tetratricopeptide repeat-like superfamily protein, pu... 139 5e-36 XP_018811520.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 1e-35 XP_012075034.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 2e-35 >XP_016204826.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 743 Score = 161 bits (407), Expect = 6e-44 Identities = 78/103 (75%), Positives = 87/103 (84%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+AL VFV AKH GLE D MSCNFLLKCLVEANRV+FVR FEEL+DSGP PN Sbjct: 172 FASNSMLENALKVFVNAKHVGLESDIMSCNFLLKCLVEANRVDFVRPFFEELKDSGPSPN 231 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN YCR G G + +IRRA E+LGK+Y SG+ PTVVT Sbjct: 232 IYTYTIMMNFYCRGGPGWDVNIRRATEILGKIYSSGQRPTVVT 274 >XP_015958293.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis duranensis] Length = 743 Score = 160 bits (405), Expect = 1e-43 Identities = 77/103 (74%), Positives = 87/103 (84%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+A +VFV AKH GLE D MSCNFLLKCLVEANRV+FVR FEEL+DSGP PN Sbjct: 170 FASNSMLENAFNVFVNAKHVGLESDIMSCNFLLKCLVEANRVDFVRPFFEELKDSGPSPN 229 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN YCR G G + +IRRA E+LGK+Y SG+ PTVVT Sbjct: 230 IYTYTIMMNFYCRGGPGWDVNIRRATEILGKIYSSGQRPTVVT 272 >XP_016197079.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis ipaensis] Length = 745 Score = 158 bits (400), Expect = 6e-43 Identities = 76/103 (73%), Positives = 86/103 (83%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+A +VFV AKH GLE D MSCNFLLKCLVE NRV+FVR FEEL+DSGP PN Sbjct: 172 FASNSMLENAFNVFVNAKHVGLESDIMSCNFLLKCLVEENRVDFVRPFFEELKDSGPSPN 231 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN YCR G G + +IRRA E+LGK+Y SG+ PTVVT Sbjct: 232 IYTYTIMMNFYCRGGPGWDVNIRRATEILGKIYSSGQRPTVVT 274 >XP_015969806.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Arachis duranensis] Length = 745 Score = 155 bits (392), Expect = 8e-42 Identities = 74/103 (71%), Positives = 85/103 (82%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+A++VFV AKH GLE D MSCNFLLKCLVE NRV+FVR FE L+D GP PN Sbjct: 172 FASNSMLENAVNVFVNAKHVGLESDIMSCNFLLKCLVETNRVDFVRLFFEALKDYGPSPN 231 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN YCR G G + +IRRA E+LGK+Y SG+ PTVVT Sbjct: 232 IYTYTIMMNFYCRGGPGWDVNIRRATEILGKIYSSGQRPTVVT 274 >XP_014622319.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622332.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622345.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622357.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] XP_014622368.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] KRH74389.1 hypothetical protein GLYMA_01G016100 [Glycine max] Length = 734 Score = 154 bits (388), Expect = 3e-41 Identities = 76/103 (73%), Positives = 87/103 (84%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ALDVF AKH GLEPD +CNFLLKCLVEANRVEFVR +FEEL+D GP PN Sbjct: 164 FASNSMLENALDVFSNAKHVGLEPDIRTCNFLLKCLVEANRVEFVRRVFEELKDRGPSPN 223 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN YC + G +A +R+AA +LGK+YRSGE PTVVT Sbjct: 224 IYTYTIMMNFYCSD-VGCDAGMRQAAVILGKIYRSGEKPTVVT 265 >XP_004512505.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cicer arietinum] XP_004512506.1 PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cicer arietinum] Length = 666 Score = 151 bits (381), Expect = 2e-40 Identities = 74/103 (71%), Positives = 84/103 (81%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLEHA VFV A+ G++P MSCNFLLKCLVEANRV VRCLFE+L++ GP PN Sbjct: 148 FASNSMLEHAYYVFVNAREVGIQPHIMSCNFLLKCLVEANRVNGVRCLFEDLKNFGPTPN 207 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN YCR+ G N DIRRAAE+LG++Y SGE TVVT Sbjct: 208 IHTYTIMMNFYCRD-VGCNVDIRRAAEILGRIYTSGETLTVVT 249 >OIV97404.1 hypothetical protein TanjilG_16165 [Lupinus angustifolius] Length = 622 Score = 150 bits (379), Expect = 2e-40 Identities = 73/103 (70%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ALDVF AKH G+EPD SCNFLLKCLVEANRV+FVR FEEL+ SGP PN Sbjct: 51 FASNSMLENALDVFFNAKHVGIEPDVRSCNFLLKCLVEANRVKFVRRFFEELKSSGPSPN 110 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMM+ YC ++ DI RA E+LGK+Y SG NPTVVT Sbjct: 111 IYTYTIMMDFYCGGDLRKDTDITRANEILGKIYTSGLNPTVVT 153 >XP_019417494.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417495.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417496.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] XP_019417497.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] Length = 744 Score = 150 bits (379), Expect = 5e-40 Identities = 73/103 (70%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ALDVF AKH G+EPD SCNFLLKCLVEANRV+FVR FEEL+ SGP PN Sbjct: 173 FASNSMLENALDVFFNAKHVGIEPDVRSCNFLLKCLVEANRVKFVRRFFEELKSSGPSPN 232 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMM+ YC ++ DI RA E+LGK+Y SG NPTVVT Sbjct: 233 IYTYTIMMDFYCGGDLRKDTDITRANEILGKIYTSGLNPTVVT 275 >GAU41461.1 hypothetical protein TSUD_237110 [Trifolium subterraneum] Length = 652 Score = 145 bits (366), Expect = 2e-38 Identities = 70/103 (67%), Positives = 84/103 (81%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASN+MLEHA VFV AK G+E + M CNFLLKCLVEANRV+ +RCLFE+L++ GP PN Sbjct: 59 FASNAMLEHAYYVFVSAKDVGIELNIMCCNFLLKCLVEANRVDGMRCLFEDLKNFGPTPN 118 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN YCR+ G + DIRRA+E+LGK+Y SGE P +VT Sbjct: 119 IHTYTIMMNFYCRD-VGCSVDIRRASEILGKIYGSGETPNIVT 160 >GAU13143.1 hypothetical protein TSUD_112040 [Trifolium subterraneum] Length = 539 Score = 144 bits (362), Expect = 3e-38 Identities = 72/103 (69%), Positives = 82/103 (79%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLEHA VFV AK G+ P+ MSCNFLLKCLVE + V+ VRCLF +L GP+PN Sbjct: 161 FASNSMLEHAYYVFVSAKDIGIVPNIMSCNFLLKCLVEKDSVDGVRCLFRDLIKFGPMPN 220 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN YCR+ G ADIRRA+E+LGK+YRS E PTVVT Sbjct: 221 IHTYTIMMNFYCRD-VGCGADIRRASEILGKIYRSRETPTVVT 262 >KHN04861.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 566 Score = 143 bits (360), Expect = 7e-38 Identities = 70/98 (71%), Positives = 81/98 (82%) Frame = +2 Query: 53 MLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPNIHTYT 232 MLE+ALDVF KH GLEPD +CNFLLKCLVEANRVEFVR +FEEL+D GP PNI+TYT Sbjct: 1 MLENALDVFSNTKHVGLEPDIRTCNFLLKCLVEANRVEFVRRVFEELKDRGPSPNIYTYT 60 Query: 233 IMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IMMN YC + G +A +R+AA +LGK+YRSGE PTVVT Sbjct: 61 IMMNFYCSD-VGCDAGMRQAAVILGKIYRSGEKPTVVT 97 >XP_017426117.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] XP_017426118.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] KOM45539.1 hypothetical protein LR48_Vigan06g084500 [Vigna angularis] BAU03138.1 hypothetical protein VIGAN_UM017900 [Vigna angularis var. angularis] Length = 732 Score = 144 bits (363), Expect = 8e-38 Identities = 70/103 (67%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE++L VFV AK+ GLEP +CNFLLKCLVEANR + VR FEEL+D GP PN Sbjct: 162 FASNSMLENSLSVFVNAKNVGLEPHIRTCNFLLKCLVEANRAKCVRWFFEELKDRGPSPN 221 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN YC GR++D+R+AA +LGK+Y+ GE PTVVT Sbjct: 222 IHTYTIMMNFYC-SNVGRDSDMRQAAAILGKIYQIGEKPTVVT 263 >XP_014519698.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63130, mitochondrial-like [Vigna radiata var. radiata] Length = 767 Score = 142 bits (359), Expect = 3e-37 Identities = 70/103 (67%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE++L VFV AK+ GLEP +CNFLLKCLVEANR + VR FEEL+D GP PN Sbjct: 162 FASNSMLENSLSVFVNAKNVGLEPHIRTCNFLLKCLVEANRAKCVRWFFEELKDRGPSPN 221 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN YC AG ++D+R+AA +LGK+Y+ GE PTVVT Sbjct: 222 IHTYTIMMNFYC-SNAGCDSDMRQAAAILGKIYQIGEKPTVVT 263 >KYP39447.1 hypothetical protein KK1_039226 [Cajanus cajan] Length = 732 Score = 141 bits (356), Expect = 7e-37 Identities = 73/103 (70%), Positives = 82/103 (79%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ALDVFV AKH GLEPD CNFLLKCLVEANR+EFV FE+L GPLPN Sbjct: 162 FASNSMLENALDVFVNAKHVGLEPDIRVCNFLLKCLVEANRLEFVGWFFEKLTAFGPLPN 221 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 I+TYTIMMN Y + G +A +RRAA +LGK+Y SGE PTVVT Sbjct: 222 IYTYTIMMNFYYND-VGCDAGMRRAAVMLGKIYLSGEKPTVVT 263 >XP_003612846.2 PPR containing plant-like protein [Medicago truncatula] AES95804.2 PPR containing plant-like protein [Medicago truncatula] Length = 722 Score = 140 bits (353), Expect = 2e-36 Identities = 73/103 (70%), Positives = 81/103 (78%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLEHA VFVRAK G+E + MSCNFLLKCLVE NRV+ VR LFE L GP PN Sbjct: 117 FASNSMLEHANYVFVRAKDDGIELNIMSCNFLLKCLVEDNRVDGVRLLFEVLIKFGPRPN 176 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 IHTYTIMMN +CR G G + DIRRA+E+LGK+Y SGE P VVT Sbjct: 177 IHTYTIMMNFFCR-GVGCSVDIRRASEILGKIYMSGETPNVVT 218 Score = 61.6 bits (148), Expect = 1e-08 Identities = 33/96 (34%), Positives = 58/96 (60%) Frame = +2 Query: 53 MLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPNIHTYT 232 +L+ A +VF K++G+ PD S + L+ RV+ +F+E+R+SG LPNI++Y+ Sbjct: 266 ILDEASEVFKEMKNSGILPDVYSYSILIDGFCRKGRVDQASEVFKEMRNSGILPNIYSYS 325 Query: 233 IMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTV 340 I+++ +C+EG + +A EV ++ SG P V Sbjct: 326 ILIDGFCKEGR-----VDKALEVFEEMKNSGILPDV 356 >KDP35484.1 hypothetical protein JCGZ_10931 [Jatropha curcas] Length = 433 Score = 137 bits (345), Expect = 2e-36 Identities = 64/103 (62%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FA N M E+ALDVFV+AK GLEP +SCNFLLKC +EAN+VEFVR LFEEL+D GP PN Sbjct: 179 FAENKMFENALDVFVQAKKFGLEPTILSCNFLLKCCIEANQVEFVRSLFEELKDFGPSPN 238 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 ++TYTIMM+ YC+ G+N DI+ A++VL ++ ++G +PTVVT Sbjct: 239 VYTYTIMMDYYCKGHLGQNIDIKEASKVLEEMEKTGRSPTVVT 281 >XP_017973975.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] XP_017973976.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] Length = 746 Score = 139 bits (350), Expect = 5e-36 Identities = 66/103 (64%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ +DVFV+AK GLEP+ MSCNFLLKCLVEANR EFVR LFE++++SGP PN Sbjct: 176 FASNSMLENGIDVFVQAKKIGLEPNIMSCNFLLKCLVEANRGEFVRSLFEDMKNSGPSPN 235 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 ++TYTIMMN YC GR+ D+ +A +L + R G+NP+VVT Sbjct: 236 VYTYTIMMNFYCNGYCGRDVDVGQANNLLEDMERGGKNPSVVT 278 >EOY25154.1 Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 139 bits (350), Expect = 5e-36 Identities = 66/103 (64%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FASNSMLE+ +DVFV+AK GLEP+ MSCNFLLKCLVEANR EFVR LFE++++SGP PN Sbjct: 176 FASNSMLENGIDVFVQAKKIGLEPNIMSCNFLLKCLVEANRGEFVRSLFEDMKNSGPSPN 235 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 ++TYTIMMN YC GR+ D+ +A +L + R G+NP+VVT Sbjct: 236 VYTYTIMMNFYCNGYCGRDVDVGQANNLLEDMERGGKNPSVVT 278 >XP_018811520.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811521.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811522.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811523.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811524.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811525.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811526.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811527.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] XP_018811529.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] Length = 749 Score = 138 bits (347), Expect = 1e-35 Identities = 64/103 (62%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FA+NSMLE+A+DV+V+ K GL+PD SCNFLLKCLVEAN+VEFV L+E+L+ SGP PN Sbjct: 174 FAANSMLENAVDVYVQTKSIGLKPDIFSCNFLLKCLVEANKVEFVTSLYEDLKQSGPSPN 233 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 ++TYTI+M YC+ G++ DI RA E+L ++ R GENPTVVT Sbjct: 234 VYTYTIIMTLYCKGHLGQDVDIGRATEILEEMERRGENPTVVT 276 >XP_012075034.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075035.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075036.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] XP_012075038.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Jatropha curcas] Length = 742 Score = 137 bits (345), Expect = 2e-35 Identities = 64/103 (62%), Positives = 83/103 (80%) Frame = +2 Query: 38 FASNSMLEHALDVFVRAKHAGLEPDAMSCNFLLKCLVEANRVEFVRCLFEELRDSGPLPN 217 FA N M E+ALDVFV+AK GLEP +SCNFLLKC +EAN+VEFVR LFEEL+D GP PN Sbjct: 179 FAENKMFENALDVFVQAKKFGLEPTILSCNFLLKCCIEANQVEFVRSLFEELKDFGPSPN 238 Query: 218 IHTYTIMMNCYCREGAGRNADIRRAAEVLGKVYRSGENPTVVT 346 ++TYTIMM+ YC+ G+N DI+ A++VL ++ ++G +PTVVT Sbjct: 239 VYTYTIMMDYYCKGHLGQNIDIKEASKVLEEMEKTGRSPTVVT 281