BLASTX nr result
ID: Glycyrrhiza35_contig00021986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00021986 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003630437.1 respiratory burst oxidase-like protein D [Medicag... 96 8e-21 AAW78863.1 respiratory burst oxidase 1, partial [Medicago trunca... 96 8e-21 KHN16903.1 Respiratory burst oxidase like protein C [Glycine soja] 95 1e-20 XP_003532261.1 PREDICTED: respiratory burst oxidase homolog prot... 95 1e-20 KHN17442.1 Respiratory burst oxidase like protein C [Glycine soja] 95 1e-20 XP_014631288.1 PREDICTED: respiratory burst oxidase homolog prot... 95 1e-20 XP_004503856.1 PREDICTED: respiratory burst oxidase homolog prot... 95 1e-20 XP_014509522.1 PREDICTED: respiratory burst oxidase homolog prot... 94 2e-20 XP_014509521.1 PREDICTED: respiratory burst oxidase homolog prot... 94 2e-20 XP_017442293.1 PREDICTED: respiratory burst oxidase homolog prot... 94 2e-20 GAU25447.1 hypothetical protein TSUD_71010 [Trifolium subterraneum] 94 4e-20 AEX56131.1 NADPH oxidase, partial [Phaseolus vulgaris] 93 7e-20 XP_007159934.1 hypothetical protein PHAVU_002G279700g [Phaseolus... 93 7e-20 KYP48980.1 Respiratory burst oxidase isogeny protein C [Cajanus ... 92 1e-19 XP_019463948.1 PREDICTED: respiratory burst oxidase homolog prot... 87 6e-18 XP_019463947.1 PREDICTED: respiratory burst oxidase homolog prot... 87 6e-18 XP_019458076.1 PREDICTED: respiratory burst oxidase homolog prot... 87 1e-17 XP_016170950.1 PREDICTED: respiratory burst oxidase homolog prot... 85 4e-17 XP_015937700.1 PREDICTED: respiratory burst oxidase homolog prot... 85 4e-17 XP_015955768.1 PREDICTED: respiratory burst oxidase homolog prot... 84 7e-17 >XP_003630437.1 respiratory burst oxidase-like protein D [Medicago truncatula] AET04913.1 respiratory burst oxidase-like protein D [Medicago truncatula] Length = 898 Score = 95.5 bits (236), Expect = 8e-21 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHPEA+VGVFYCGPS LTH LRQL+LDFSHNTSTKFDFHKENF Sbjct: 852 RIALNHPEAQVGVFYCGPSTLTHELRQLSLDFSHNTSTKFDFHKENF 898 >AAW78863.1 respiratory burst oxidase 1, partial [Medicago truncatula] Length = 932 Score = 95.5 bits (236), Expect = 8e-21 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHPEA+VGVFYCGPS LTH LRQL+LDFSHNTSTKFDFHKENF Sbjct: 886 RIALNHPEAQVGVFYCGPSTLTHELRQLSLDFSHNTSTKFDFHKENF 932 >KHN16903.1 Respiratory burst oxidase like protein C [Glycine soja] Length = 816 Score = 95.1 bits (235), Expect = 1e-20 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 770 RIALNHPDARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 816 >XP_003532261.1 PREDICTED: respiratory burst oxidase homolog protein C-like [Glycine max] KRH41026.1 hypothetical protein GLYMA_08G005900 [Glycine max] Length = 888 Score = 95.1 bits (235), Expect = 1e-20 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 842 RIALNHPDARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 888 >KHN17442.1 Respiratory burst oxidase like protein C [Glycine soja] Length = 898 Score = 95.1 bits (235), Expect = 1e-20 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 852 RIALNHPDARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 898 >XP_014631288.1 PREDICTED: respiratory burst oxidase homolog protein C [Glycine max] KRH59706.1 hypothetical protein GLYMA_05G198700 [Glycine max] Length = 898 Score = 95.1 bits (235), Expect = 1e-20 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 852 RIALNHPDARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 898 >XP_004503856.1 PREDICTED: respiratory burst oxidase homolog protein D-like [Cicer arietinum] Length = 933 Score = 95.1 bits (235), Expect = 1e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHPEARVGVFYCGPS LTH L QLALDFSHNTSTK+DFHKENF Sbjct: 887 RIALNHPEARVGVFYCGPSTLTHELHQLALDFSHNTSTKYDFHKENF 933 >XP_014509522.1 PREDICTED: respiratory burst oxidase homolog protein C isoform X2 [Vigna radiata var. radiata] Length = 874 Score = 94.4 bits (233), Expect = 2e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 828 RIALNHPHARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 874 >XP_014509521.1 PREDICTED: respiratory burst oxidase homolog protein C isoform X1 [Vigna radiata var. radiata] Length = 897 Score = 94.4 bits (233), Expect = 2e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 851 RIALNHPHARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 897 >XP_017442293.1 PREDICTED: respiratory burst oxidase homolog protein D [Vigna angularis] KOM30505.1 hypothetical protein LR48_Vigan01g005900 [Vigna angularis] BAT73182.1 hypothetical protein VIGAN_01064500 [Vigna angularis var. angularis] Length = 900 Score = 94.4 bits (233), Expect = 2e-20 Identities = 43/47 (91%), Positives = 44/47 (93%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP ARVGVFYCGPS LTH LRQLALDFSHNTSTK+DFHKENF Sbjct: 854 RIALNHPHARVGVFYCGPSALTHELRQLALDFSHNTSTKYDFHKENF 900 >GAU25447.1 hypothetical protein TSUD_71010 [Trifolium subterraneum] Length = 865 Score = 93.6 bits (231), Expect = 4e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP ARVGVFYCGPS LTH LRQL+LDFSHNTSTK+DFHKENF Sbjct: 819 RIALNHPAARVGVFYCGPSTLTHELRQLSLDFSHNTSTKYDFHKENF 865 >AEX56131.1 NADPH oxidase, partial [Phaseolus vulgaris] Length = 876 Score = 92.8 bits (229), Expect = 7e-20 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP RVGVFYCGPSNLT LRQL+LDFSHNTSTKFDFHKENF Sbjct: 830 RIALNHPHGRVGVFYCGPSNLTRELRQLSLDFSHNTSTKFDFHKENF 876 >XP_007159934.1 hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris] ESW31928.1 hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris] Length = 899 Score = 92.8 bits (229), Expect = 7e-20 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP RVGVFYCGPSNLT LRQL+LDFSHNTSTKFDFHKENF Sbjct: 853 RIALNHPHGRVGVFYCGPSNLTRELRQLSLDFSHNTSTKFDFHKENF 899 >KYP48980.1 Respiratory burst oxidase isogeny protein C [Cajanus cajan] Length = 867 Score = 92.0 bits (227), Expect = 1e-19 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ARVGVFYCGP+++TH LRQLALDFSHNTST +DFHKENF Sbjct: 821 RIALNHPQARVGVFYCGPASITHELRQLALDFSHNTSTTYDFHKENF 867 >XP_019463948.1 PREDICTED: respiratory burst oxidase homolog protein C isoform X2 [Lupinus angustifolius] OIW00222.1 hypothetical protein TanjilG_27473 [Lupinus angustifolius] Length = 894 Score = 87.4 bits (215), Expect = 6e-18 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+++VGVFYCGP+ LT LRQ ALDFSHNTSTKFDFHKENF Sbjct: 848 RIALNHPDSQVGVFYCGPAALTKQLRQFALDFSHNTSTKFDFHKENF 894 >XP_019463947.1 PREDICTED: respiratory burst oxidase homolog protein C isoform X1 [Lupinus angustifolius] Length = 895 Score = 87.4 bits (215), Expect = 6e-18 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+++VGVFYCGP+ LT LRQ ALDFSHNTSTKFDFHKENF Sbjct: 849 RIALNHPDSQVGVFYCGPAALTKQLRQFALDFSHNTSTKFDFHKENF 895 >XP_019458076.1 PREDICTED: respiratory burst oxidase homolog protein C-like [Lupinus angustifolius] Length = 906 Score = 86.7 bits (213), Expect = 1e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP+ RVGVFYCGP+ LT LRQL+LDFSHNTSTK+DFHKENF Sbjct: 860 RIALNHPKDRVGVFYCGPAALTKELRQLSLDFSHNTSTKYDFHKENF 906 >XP_016170950.1 PREDICTED: respiratory burst oxidase homolog protein C [Arachis ipaensis] Length = 971 Score = 85.1 bits (209), Expect = 4e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP AR+GVFYCGP LT LRQLA DFSHNT+TK+DFHKENF Sbjct: 925 RIALNHPHARIGVFYCGPPALTKELRQLASDFSHNTTTKYDFHKENF 971 >XP_015937700.1 PREDICTED: respiratory burst oxidase homolog protein C [Arachis duranensis] Length = 973 Score = 85.1 bits (209), Expect = 4e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP AR+GVFYCGP LT LRQLA DFSHNT+TK+DFHKENF Sbjct: 927 RIALNHPHARIGVFYCGPPALTKELRQLASDFSHNTTTKYDFHKENF 973 >XP_015955768.1 PREDICTED: respiratory burst oxidase homolog protein C [Arachis duranensis] Length = 880 Score = 84.3 bits (207), Expect = 7e-17 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -2 Query: 310 RIALNHPEARVGVFYCGPSNLTHGLRQLALDFSHNTSTKFDFHKENF 170 RIALNHP ARVGVFYCG LT LRQL+LDFSHNTSTKF+FHKENF Sbjct: 834 RIALNHPHARVGVFYCGSPALTKQLRQLSLDFSHNTSTKFEFHKENF 880