BLASTX nr result
ID: Glycyrrhiza35_contig00021891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00021891 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35342.1 hypothetical protein TSUD_337340 [Trifolium subterran... 84 6e-19 XP_003625566.2 PPR containing plant-like protein [Medicago trunc... 88 6e-18 XP_019425441.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 2e-15 XP_016207950.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 7e-14 XP_016207949.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 7e-14 XP_007162712.1 hypothetical protein PHAVU_001G174000g [Phaseolus... 76 9e-14 XP_007162713.1 hypothetical protein PHAVU_001G174000g [Phaseolus... 76 9e-14 XP_015970001.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 XP_015970000.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 XP_014629345.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 6e-13 KRH67629.1 hypothetical protein GLYMA_03G177000 [Glycine max] 74 6e-13 XP_017418557.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 KRG95908.1 hypothetical protein GLYMA_19G177700 [Glycine max] 71 7e-12 KHN02376.1 Pentatricopeptide repeat-containing protein, chloropl... 71 7e-12 XP_003554352.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 7e-12 XP_014495824.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 1e-11 XP_012569427.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 XP_004493936.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 KYP70834.1 hypothetical protein KK1_010072 [Cajanus cajan] 60 4e-08 XP_018835388.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 7e-07 >GAU35342.1 hypothetical protein TSUD_337340 [Trifolium subterraneum] Length = 82 Score = 84.0 bits (206), Expect = 6e-19 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSI 165 +L+ P LS+L+IEALP ENAL+TT F TRRPAVLQRLKVTKKSL+RWLQRK S+ Sbjct: 27 ELQTPKLSHLSIEALPEENALTTTTGFHTRRPAVLQRLKVTKKSLHRWLQRKGSV 81 >XP_003625566.2 PPR containing plant-like protein [Medicago truncatula] AES81784.2 PPR containing plant-like protein [Medicago truncatula] Length = 808 Score = 88.2 bits (217), Expect = 6e-18 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KL+NP SNL IEALP ENAL T+M F TRRPAVLQRLKVTKKSL+RWLQRK ++K Sbjct: 753 KLQNPEFSNLTIEALPGENALPTSMGFHTRRPAVLQRLKVTKKSLHRWLQRKSNVK 808 >XP_019425441.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Lupinus angustifolius] OIV92143.1 hypothetical protein TanjilG_18715 [Lupinus angustifolius] Length = 834 Score = 81.3 bits (199), Expect = 2e-15 Identities = 40/56 (71%), Positives = 44/56 (78%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KLEN LSNLNIEALPREN L T + F R PAVL RLKVTKKSLY WL RKV+++ Sbjct: 776 KLENSKLSNLNIEALPRENVLPTRIGFHKRSPAVLHRLKVTKKSLYHWLHRKVTVE 831 >XP_016207950.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Arachis ipaensis] Length = 817 Score = 76.6 bits (187), Expect = 7e-14 Identities = 42/56 (75%), Positives = 45/56 (80%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KLE PNL+NL+IEALP E AL+TT RRPAVL RLKVTKKSLY WL RKVSIK Sbjct: 767 KLEIPNLTNLSIEALPGEKALTTT-----RRPAVLHRLKVTKKSLYGWLHRKVSIK 817 >XP_016207949.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Arachis ipaensis] Length = 820 Score = 76.6 bits (187), Expect = 7e-14 Identities = 42/56 (75%), Positives = 45/56 (80%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KLE PNL+NL+IEALP E AL+TT RRPAVL RLKVTKKSLY WL RKVSIK Sbjct: 770 KLEIPNLTNLSIEALPGEKALTTT-----RRPAVLHRLKVTKKSLYGWLHRKVSIK 820 >XP_007162712.1 hypothetical protein PHAVU_001G174000g [Phaseolus vulgaris] ESW34706.1 hypothetical protein PHAVU_001G174000g [Phaseolus vulgaris] Length = 594 Score = 76.3 bits (186), Expect = 9e-14 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KL+NP L+NL IEA+P E+AL T+M FQTRRP +L RLK+T+KSLY WL RK Sbjct: 543 KLKNPTLANLKIEAVPAEDALPTSMGFQTRRPGILVRLKITRKSLYSWLHRK 594 >XP_007162713.1 hypothetical protein PHAVU_001G174000g [Phaseolus vulgaris] ESW34707.1 hypothetical protein PHAVU_001G174000g [Phaseolus vulgaris] Length = 809 Score = 76.3 bits (186), Expect = 9e-14 Identities = 35/52 (67%), Positives = 43/52 (82%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KL+NP L+NL IEA+P E+AL T+M FQTRRP +L RLK+T+KSLY WL RK Sbjct: 758 KLKNPTLANLKIEAVPAEDALPTSMGFQTRRPGILVRLKITRKSLYSWLHRK 809 >XP_015970001.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Arachis duranensis] Length = 816 Score = 75.5 bits (184), Expect = 2e-13 Identities = 41/56 (73%), Positives = 45/56 (80%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KLE PNL+NL+IEALP E AL+TT RRPAVL RLKVTKKSLY WL RK+SIK Sbjct: 766 KLEIPNLTNLSIEALPGEKALTTT-----RRPAVLHRLKVTKKSLYGWLHRKLSIK 816 >XP_015970000.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Arachis duranensis] Length = 819 Score = 75.5 bits (184), Expect = 2e-13 Identities = 41/56 (73%), Positives = 45/56 (80%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 KLE PNL+NL+IEALP E AL+TT RRPAVL RLKVTKKSLY WL RK+SIK Sbjct: 769 KLEIPNLTNLSIEALPGEKALTTT-----RRPAVLHRLKVTKKSLYGWLHRKLSIK 819 >XP_014629345.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Length = 517 Score = 73.9 bits (180), Expect = 6e-13 Identities = 40/52 (76%), Positives = 40/52 (76%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KLE PN SNLNIEALP ENAL FQTRRP VL RLKVTKKSLY WL RK Sbjct: 470 KLEYPNRSNLNIEALPGENALG----FQTRRPGVLVRLKVTKKSLYSWLHRK 517 >KRH67629.1 hypothetical protein GLYMA_03G177000 [Glycine max] Length = 544 Score = 73.9 bits (180), Expect = 6e-13 Identities = 40/52 (76%), Positives = 40/52 (76%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KLE PN SNLNIEALP ENAL FQTRRP VL RLKVTKKSLY WL RK Sbjct: 470 KLEYPNRSNLNIEALPGENALG----FQTRRPGVLVRLKVTKKSLYSWLHRK 517 >XP_017418557.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vigna angularis] KOM38963.1 hypothetical protein LR48_Vigan03g234500 [Vigna angularis] Length = 809 Score = 72.0 bits (175), Expect = 3e-12 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KL++PN +NL I ALP E+AL T FQTRRPA+L RLKVT+KSLY WL RK Sbjct: 758 KLKHPNFANLKIGALPGEDALPTLTGFQTRRPAILVRLKVTRKSLYSWLHRK 809 >KRG95908.1 hypothetical protein GLYMA_19G177700 [Glycine max] Length = 585 Score = 70.9 bits (172), Expect = 7e-12 Identities = 38/51 (74%), Positives = 39/51 (76%) Frame = +1 Query: 4 LENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 LE PN SNL+IEA P ENAL FQTRRP VL RLKVTKKSLYRWL RK Sbjct: 539 LEYPNFSNLSIEAQPGENALG----FQTRRPGVLVRLKVTKKSLYRWLHRK 585 >KHN02376.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 784 Score = 70.9 bits (172), Expect = 7e-12 Identities = 38/51 (74%), Positives = 39/51 (76%) Frame = +1 Query: 4 LENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 LE PN SNL+IEA P ENAL FQTRRP VL RLKVTKKSLYRWL RK Sbjct: 738 LEYPNFSNLSIEAQPGENALG----FQTRRPGVLVRLKVTKKSLYRWLHRK 784 >XP_003554352.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Glycine max] KRG95907.1 hypothetical protein GLYMA_19G177700 [Glycine max] Length = 811 Score = 70.9 bits (172), Expect = 7e-12 Identities = 38/51 (74%), Positives = 39/51 (76%) Frame = +1 Query: 4 LENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 LE PN SNL+IEA P ENAL FQTRRP VL RLKVTKKSLYRWL RK Sbjct: 765 LEYPNFSNLSIEAQPGENALG----FQTRRPGVLVRLKVTKKSLYRWLHRK 811 >XP_014495824.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vigna radiata var. radiata] Length = 811 Score = 70.5 bits (171), Expect = 1e-11 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 1 KLENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 KL++PN +NL I ALP E+AL T FQTRRP +L RLKVT+KSLY WL RK Sbjct: 760 KLKHPNFANLKIGALPGEDALPTLTGFQTRRPGILVRLKVTRKSLYSWLHRK 811 >XP_012569427.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Cicer arietinum] Length = 798 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +1 Query: 7 ENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 ++P L N +ENAL TTM F TRRPAVLQRLKVTK+SL+RWLQR+VS+K Sbjct: 751 DSPKLQNT------KENALPTTMVFHTRRPAVLQRLKVTKQSLHRWLQRRVSVK 798 >XP_004493936.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Cicer arietinum] Length = 799 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +1 Query: 7 ENPNLSNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKVSIK 168 ++P L N +ENAL TTM F TRRPAVLQRLKVTK+SL+RWLQR+VS+K Sbjct: 752 DSPKLQNT------KENALPTTMVFHTRRPAVLQRLKVTKQSLHRWLQRRVSVK 799 >KYP70834.1 hypothetical protein KK1_010072 [Cajanus cajan] Length = 787 Score = 60.1 bits (144), Expect = 4e-08 Identities = 35/53 (66%), Positives = 37/53 (69%), Gaps = 8/53 (15%) Frame = +1 Query: 22 SNLNIEALP-------RENALSTT-MEFQTRRPAVLQRLKVTKKSLYRWLQRK 156 + L +E LP RENAL TT M FQTRRPAVL RLKVTKKSLY WL RK Sbjct: 735 NELGLEVLPARTRVALRENALPTTKMGFQTRRPAVLVRLKVTKKSLYSWLHRK 787 >XP_018835388.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Juglans regia] Length = 861 Score = 56.6 bits (135), Expect = 7e-07 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +1 Query: 22 SNLNIEALPRENALSTTMEFQTRRPAVLQRLKVTKKSLYRWLQRKV 159 S++N+E L N+L +E TRRPA++QRLK+T+KSL+ WLQR+V Sbjct: 811 SDINLEELIGRNSLPAKLECSTRRPAIVQRLKITRKSLHYWLQRRV 856