BLASTX nr result
ID: Glycyrrhiza35_contig00021847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00021847 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU13324.1 hypothetical protein TSUD_42780 [Trifolium subterraneum] 70 2e-12 XP_003592075.1 AP2 domain class transcription factor [Medicago t... 71 3e-12 XP_004496448.1 PREDICTED: ethylene-responsive transcription fact... 69 2e-11 XP_012570084.1 PREDICTED: ethylene-responsive transcription fact... 69 2e-11 XP_004498983.1 PREDICTED: ethylene-responsive transcription fact... 66 1e-10 XP_012570781.1 PREDICTED: ethylene-responsive transcription fact... 66 1e-10 XP_019452755.1 PREDICTED: ethylene-responsive transcription fact... 65 3e-10 XP_019452750.1 PREDICTED: ethylene-responsive transcription fact... 65 3e-10 XP_007143561.1 hypothetical protein PHAVU_007G082000g [Phaseolus... 63 1e-09 XP_014512914.1 PREDICTED: ethylene-responsive transcription fact... 62 3e-09 XP_017413598.1 PREDICTED: ethylene-responsive transcription fact... 61 6e-09 BAT94331.1 hypothetical protein VIGAN_08092800 [Vigna angularis ... 61 8e-09 KOM35862.1 hypothetical protein LR48_Vigan02g201200 [Vigna angul... 61 8e-09 KYP50583.1 Ethylene-responsive transcription factor ERF112 famil... 57 2e-07 XP_006606168.1 PREDICTED: ethylene-responsive transcription fact... 57 2e-07 XP_006589489.1 PREDICTED: ethylene-responsive transcription fact... 57 3e-07 >GAU13324.1 hypothetical protein TSUD_42780 [Trifolium subterraneum] Length = 209 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 +SDL+RDY QYSQ+LKGSGDF GLEQWFYESQMAA++ Sbjct: 85 TSDLLRDYYQYSQILKGSGDFQGLEQWFYESQMAAIH 121 >XP_003592075.1 AP2 domain class transcription factor [Medicago truncatula] AES62326.1 AP2 domain class transcription factor [Medicago truncatula] Length = 362 Score = 70.9 bits (172), Expect = 3e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 SSD++RDY QYSQLLKGSGDF GLEQWFYESQMAA++ Sbjct: 242 SSDMLRDYYQYSQLLKGSGDFQGLEQWFYESQMAAIH 278 >XP_004496448.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X2 [Cicer arietinum] Length = 348 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 SSDL+RDY QYSQ+LKGS DF GLEQWFYESQMAA++ Sbjct: 229 SSDLLRDYYQYSQILKGSADFQGLEQWFYESQMAAIH 265 >XP_012570084.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Cicer arietinum] Length = 353 Score = 68.6 bits (166), Expect = 2e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 SSDL+RDY QYSQ+LKGS DF GLEQWFYESQMAA++ Sbjct: 234 SSDLLRDYYQYSQILKGSADFQGLEQWFYESQMAAIH 270 >XP_004498983.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X2 [Cicer arietinum] Length = 298 Score = 66.2 bits (160), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 SSDL+ DY QYSQ+LKGS DF GLEQWFYESQMAA++ Sbjct: 194 SSDLLTDYYQYSQILKGSADFQGLEQWFYESQMAAIH 230 >XP_012570781.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Cicer arietinum] XP_012570782.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Cicer arietinum] Length = 303 Score = 66.2 bits (160), Expect = 1e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAALY 203 SSDL+ DY QYSQ+LKGS DF GLEQWFYESQMAA++ Sbjct: 199 SSDLLTDYYQYSQILKGSADFQGLEQWFYESQMAAIH 235 >XP_019452755.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X2 [Lupinus angustifolius] Length = 298 Score = 65.1 bits (157), Expect = 3e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S+DLMRDY QYSQLLK SGD+HGL+QWFY+S MA L Sbjct: 194 SNDLMRDYWQYSQLLKASGDYHGLDQWFYDSHMATL 229 >XP_019452750.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Lupinus angustifolius] XP_019452752.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Lupinus angustifolius] XP_019452753.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Lupinus angustifolius] XP_019452754.1 PREDICTED: ethylene-responsive transcription factor ERF110-like isoform X1 [Lupinus angustifolius] OIW06583.1 hypothetical protein TanjilG_03977 [Lupinus angustifolius] Length = 304 Score = 65.1 bits (157), Expect = 3e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S+DLMRDY QYSQLLK SGD+HGL+QWFY+S MA L Sbjct: 200 SNDLMRDYWQYSQLLKASGDYHGLDQWFYDSHMATL 235 >XP_007143561.1 hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris] XP_007143562.1 hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris] ESW15555.1 hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris] ESW15556.1 hypothetical protein PHAVU_007G082000g [Phaseolus vulgaris] Length = 268 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 SSDL+RDY YS LL+ +GDFHGLEQWFY+SQMAAL Sbjct: 166 SSDLLRDYWGYSLLLRSTGDFHGLEQWFYDSQMAAL 201 >XP_014512914.1 PREDICTED: ethylene-responsive transcription factor ABR1-like [Vigna radiata var. radiata] Length = 347 Score = 62.4 bits (150), Expect = 3e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S DL+RDY YSQLL+ +G+FHGLEQWFY+SQMAAL Sbjct: 242 SPDLLRDYWGYSQLLRSTGEFHGLEQWFYDSQMAAL 277 >XP_017413598.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Vigna angularis] XP_017413600.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Vigna angularis] XP_017413601.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Vigna angularis] XP_017413602.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Vigna angularis] XP_017413603.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Vigna angularis] Length = 271 Score = 61.2 bits (147), Expect = 6e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S DL+RDY YSQLL+ +G+FHGL+QWFY+SQMAAL Sbjct: 166 SPDLLRDYWGYSQLLRSTGEFHGLDQWFYDSQMAAL 201 >BAT94331.1 hypothetical protein VIGAN_08092800 [Vigna angularis var. angularis] Length = 355 Score = 61.2 bits (147), Expect = 8e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S DL+RDY YSQLL+ +G+FHGL+QWFY+SQMAAL Sbjct: 250 SPDLLRDYWGYSQLLRSTGEFHGLDQWFYDSQMAAL 285 >KOM35862.1 hypothetical protein LR48_Vigan02g201200 [Vigna angularis] Length = 365 Score = 61.2 bits (147), Expect = 8e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 S DL+RDY YSQLL+ +G+FHGL+QWFY+SQMAAL Sbjct: 260 SPDLLRDYWGYSQLLRSTGEFHGLDQWFYDSQMAAL 295 >KYP50583.1 Ethylene-responsive transcription factor ERF112 family [Cajanus cajan] Length = 251 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAAL 206 SSD++RDY YSQLL GSG+FHGL+ W ++SQMA L Sbjct: 148 SSDVLRDYWGYSQLLSGSGEFHGLDPWLFDSQMATL 183 >XP_006606168.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Glycine max] XP_006606169.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Glycine max] XP_006606171.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Glycine max] XP_006606172.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Glycine max] XP_014627801.1 PREDICTED: ethylene-responsive transcription factor ERF110 [Glycine max] KRG91682.1 hypothetical protein GLYMA_20G168500 [Glycine max] KRG91683.1 hypothetical protein GLYMA_20G168500 [Glycine max] Length = 279 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAA 209 SS +RDY YSQLL+ +GDFHGL+QWF++SQMAA Sbjct: 170 SSAFLRDYWGYSQLLRSTGDFHGLDQWFFDSQMAA 204 >XP_006589489.1 PREDICTED: ethylene-responsive transcription factor ERF110-like [Glycine max] XP_014618826.1 PREDICTED: ethylene-responsive transcription factor ERF110-like [Glycine max] KRH35113.1 hypothetical protein GLYMA_10G223200 [Glycine max] Length = 273 Score = 56.6 bits (135), Expect = 3e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 313 SSDLMRDYLQYSQLLKGSGDFHGLEQWFYESQMAA 209 SSD +RDY YSQLL+ +G+FHGL+ WF++SQMAA Sbjct: 163 SSDFLRDYWGYSQLLRSTGEFHGLDHWFFDSQMAA 197