BLASTX nr result
ID: Glycyrrhiza35_contig00021626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00021626 (202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016182307.1 PREDICTED: putative disease resistance RPP13-like... 56 2e-07 XP_013442215.1 NB-ARC domain disease resistance protein, putativ... 56 2e-07 KYP41963.1 Putative disease resistance RPP13-like protein 1 [Caj... 55 3e-07 CAC86495.1 RGA-F protein, partial [Cicer arietinum] 54 3e-07 XP_004498673.1 PREDICTED: putative disease resistance RPP13-like... 54 8e-07 XP_003598492.1 LRR and NB-ARC domain disease resistance protein ... 53 2e-06 XP_013466886.1 LRR and NB-ARC domain disease resistance protein ... 53 2e-06 XP_016202976.1 PREDICTED: putative disease resistance protein At... 52 4e-06 XP_003599514.1 LRR and NB-ARC domain disease resistance protein ... 52 4e-06 XP_003599519.1 LRR and NB-ARC domain disease resistance protein ... 52 4e-06 XP_016206157.1 PREDICTED: putative disease resistance RPP13-like... 52 5e-06 XP_015953773.1 PREDICTED: putative disease resistance protein At... 52 5e-06 XP_003599377.1 LRR and NB-ARC domain disease resistance protein ... 52 5e-06 KYP41054.1 Putative disease resistance RPP13-like protein 1 [Caj... 51 7e-06 KYP41066.1 Putative disease resistance RPP13-like protein 1 [Caj... 51 7e-06 XP_003599348.1 LRR and NB-ARC domain disease resistance protein ... 51 7e-06 XP_015881572.1 PREDICTED: putative disease resistance RPP13-like... 51 1e-05 >XP_016182307.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Arachis ipaensis] XP_016182308.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Arachis ipaensis] Length = 1104 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND EV++KF KAWA +SKD DV R TKTVLESVTS Sbjct: 219 YNDDEVKDKFDLKAWACVSKDFDVFRVTKTVLESVTS 255 >XP_013442215.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] KEH16240.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 1982 Score = 55.8 bits (133), Expect = 2e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YNDPEV+EKF K WA ISKD D+ R TKT+LESVT Sbjct: 206 YNDPEVKEKFDLKGWAYISKDFDIVRVTKTLLESVT 241 >KYP41963.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1071 Score = 55.1 bits (131), Expect = 3e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YND +VQEKF KAWA ISKD DV R TKT+LESVT Sbjct: 212 YNDLDVQEKFDLKAWAYISKDFDVCRVTKTILESVT 247 >CAC86495.1 RGA-F protein, partial [Cicer arietinum] Length = 185 Score = 53.9 bits (128), Expect = 3e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YNDPEV EKF K WA ISKD D+ R TKT+LES T Sbjct: 13 YNDPEVNEKFDLKGWAYISKDFDIVRVTKTLLESAT 48 >XP_004498673.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X1 [Cicer arietinum] XP_004498674.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X2 [Cicer arietinum] Length = 1238 Score = 53.9 bits (128), Expect = 8e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YNDPEV EKF K WA ISKD D+ R TKT+LES T Sbjct: 206 YNDPEVNEKFDLKGWAYISKDFDIVRVTKTLLESAT 241 >XP_003598492.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68743.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1291 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND EV+EKF+ + WA ISKD DV TKT+LESVTS Sbjct: 216 YNDREVKEKFEVRGWAHISKDFDVVTVTKTILESVTS 252 >XP_013466886.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] KEH40927.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1503 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND EV+EKF+ + WA ISKD DV TKT+LESVTS Sbjct: 216 YNDREVKEKFEVRGWAHISKDFDVVTVTKTILESVTS 252 >XP_016202976.1 PREDICTED: putative disease resistance protein At3g14460, partial [Arachis ipaensis] Length = 1227 Score = 52.0 bits (123), Expect = 4e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YNDP+V+ KF KAWA +SKD DV + K++LES+TS Sbjct: 217 YNDPQVKAKFDVKAWASVSKDFDVVKLAKSLLESITS 253 >XP_003599514.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES69765.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1251 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND +VQE F KAWA +S+D D+ R TKT+LESVTS Sbjct: 216 YNDEKVQEHFDLKAWACVSEDFDILRVTKTLLESVTS 252 >XP_003599519.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES69770.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1276 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND +VQE F KAWA +S+D D+ R TKT+LESVTS Sbjct: 216 YNDEKVQEHFDLKAWACVSEDFDILRVTKTLLESVTS 252 >XP_016206157.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X3 [Arachis ipaensis] Length = 1224 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND +V+EKF KAWA +SKD DV + K++LESVTS Sbjct: 217 YNDAQVKEKFDVKAWASVSKDFDVVKLAKSLLESVTS 253 >XP_015953773.1 PREDICTED: putative disease resistance protein At3g14460, partial [Arachis duranensis] Length = 1243 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND +V EKF KAWA +SKD DV + K++LESVTS Sbjct: 218 YNDAQVNEKFDAKAWASVSKDFDVVKLAKSLLESVTS 254 >XP_003599377.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES69628.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1256 Score = 51.6 bits (122), Expect = 5e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND EVQ+ F KAWA +S+D D+ R TK++LESVTS Sbjct: 220 YNDKEVQQHFDMKAWACVSEDFDIMRVTKSLLESVTS 256 >KYP41054.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 993 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YND +VQEKF KAWA IS D DV + T+T+LESVT Sbjct: 219 YNDRDVQEKFDLKAWAYISNDFDVCKVTRTILESVT 254 >KYP41066.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1173 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YND +VQEKF KAWA IS D DV + T+T+LESVT Sbjct: 219 YNDRDVQEKFDLKAWAYISNDFDVCKVTRTILESVT 254 >XP_003599348.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES69599.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1273 Score = 51.2 bits (121), Expect = 7e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVTS 3 YND EVQ+ F KAWA +S+D D+ R TK++LESVTS Sbjct: 220 YNDKEVQQHFDLKAWACVSEDFDIMRVTKSLLESVTS 256 >XP_015881572.1 PREDICTED: putative disease resistance RPP13-like protein 1 [Ziziphus jujuba] Length = 1181 Score = 50.8 bits (120), Expect = 1e-05 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 113 YNDPEVQEKFQPKAWAPISKDLDVRRFTKTVLESVT 6 YND EVQE+F KAWA +S D DV R TK +LES+T Sbjct: 216 YNDDEVQERFDIKAWACVSDDFDVFRITKIILESIT 251