BLASTX nr result
ID: Glycyrrhiza35_contig00021461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00021461 (544 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015939771.1 PREDICTED: 26S protease regulatory subunit 6A hom... 100 1e-21 KRG92900.1 hypothetical protein GLYMA_20G236500 [Glycine max] 99 2e-21 KYP74310.1 26S protease regulatory subunit 6A isogeny [Cajanus c... 99 3e-21 XP_019453281.1 PREDICTED: 26S protease regulatory subunit 6A hom... 99 4e-21 XP_007144949.1 hypothetical protein PHAVU_007G197100g [Phaseolus... 99 4e-21 XP_006606532.1 PREDICTED: 26S protease regulatory subunit 6A hom... 99 4e-21 XP_016205557.1 PREDICTED: 26S protease regulatory subunit 6A hom... 99 5e-21 XP_014514656.1 PREDICTED: 26S protease regulatory subunit 6A hom... 99 5e-21 KHN16103.1 26S protease regulatory subunit 6A like A [Glycine so... 99 5e-21 NP_001242579.1 uncharacterized protein LOC100798637 [Glycine max... 99 5e-21 XP_015968622.1 PREDICTED: 26S protease regulatory subunit 6A hom... 98 7e-21 GAU29366.1 hypothetical protein TSUD_31720 [Trifolium subterraneum] 97 1e-20 XP_015933548.1 PREDICTED: 26S protease regulatory subunit 6A hom... 97 1e-20 KRH67108.1 hypothetical protein GLYMA_03G147400 [Glycine max] 91 2e-20 XP_010039946.1 PREDICTED: 26S protease regulatory subunit 6A hom... 96 4e-20 KCW45605.1 hypothetical protein EUGRSUZ_L00637 [Eucalyptus grandis] 96 5e-20 XP_008778070.2 PREDICTED: 26S protease regulatory subunit 6A hom... 89 6e-20 XP_015875105.1 PREDICTED: 26S protease regulatory subunit 6A hom... 96 7e-20 XP_019418866.1 PREDICTED: 26S protease regulatory subunit 6A hom... 95 9e-20 XP_018841804.1 PREDICTED: 26S protease regulatory subunit 6A hom... 95 9e-20 >XP_015939771.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] XP_016175849.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis ipaensis] Length = 423 Score = 100 bits (249), Expect = 1e-21 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VEDTSFEDDQLANMTT+DIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDTSFEDDQLANMTTEDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >KRG92900.1 hypothetical protein GLYMA_20G236500 [Glycine max] Length = 355 Score = 99.0 bits (245), Expect = 2e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDANFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >KYP74310.1 26S protease regulatory subunit 6A isogeny [Cajanus cajan] Length = 423 Score = 99.4 bits (246), Expect = 3e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED++FEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDSTFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_019453281.1 PREDICTED: 26S protease regulatory subunit 6A homolog B [Lupinus angustifolius] OIW07110.1 hypothetical protein TanjilG_02744 [Lupinus angustifolius] Length = 423 Score = 99.0 bits (245), Expect = 4e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MA+A+VEDTSFEDDQLANMTTDDI RASRLLDNEIR+LKEELQRTNLELESYK Sbjct: 1 MATAMVEDTSFEDDQLANMTTDDIARASRLLDNEIRVLKEELQRTNLELESYK 53 >XP_007144949.1 hypothetical protein PHAVU_007G197100g [Phaseolus vulgaris] ESW16943.1 hypothetical protein PHAVU_007G197100g [Phaseolus vulgaris] Length = 423 Score = 99.0 bits (245), Expect = 4e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDATFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_006606532.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Glycine max] KHN20243.1 26S protease regulatory subunit 6A like A [Glycine soja] KRG92899.1 hypothetical protein GLYMA_20G236500 [Glycine max] Length = 423 Score = 99.0 bits (245), Expect = 4e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDANFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_016205557.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis ipaensis] XP_016170747.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis ipaensis] Length = 423 Score = 98.6 bits (244), Expect = 5e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VEDT+ EDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDTNLEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_014514656.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Vigna radiata var. radiata] XP_017415569.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Vigna angularis] KOM35516.1 hypothetical protein LR48_Vigan02g166600 [Vigna angularis] BAT95076.1 hypothetical protein VIGAN_08173900 [Vigna angularis var. angularis] Length = 423 Score = 98.6 bits (244), Expect = 5e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDD+VRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDATFEDDQLANMTTDDVVRASRLLDNEIRILKEELQRTNLELESYK 53 >KHN16103.1 26S protease regulatory subunit 6A like A [Glycine soja] KRH33891.1 hypothetical protein GLYMA_10G151900 [Glycine max] Length = 423 Score = 98.6 bits (244), Expect = 5e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDD+VRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDANFEDDQLANMTTDDVVRASRLLDNEIRILKEELQRTNLELESYK 53 >NP_001242579.1 uncharacterized protein LOC100798637 [Glycine max] ACU18883.1 unknown [Glycine max] Length = 423 Score = 98.6 bits (244), Expect = 5e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED +FEDDQLANMTTDD+VRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDANFEDDQLANMTTDDVVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_015968622.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] XP_015968623.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] Length = 423 Score = 98.2 bits (243), Expect = 7e-21 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VEDT+ EDDQLANMTTDD+VRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDTNLEDDQLANMTTDDVVRASRLLDNEIRILKEELQRTNLELESYK 53 >GAU29366.1 hypothetical protein TSUD_31720 [Trifolium subterraneum] Length = 423 Score = 97.4 bits (241), Expect = 1e-20 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VED++FEDDQLANM TDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASAMVEDSNFEDDQLANMNTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >XP_015933548.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] XP_015933550.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] XP_015933551.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Arachis duranensis] Length = 423 Score = 97.4 bits (241), Expect = 1e-20 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MAS++VEDT+ EDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MASSMVEDTNLEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >KRH67108.1 hypothetical protein GLYMA_03G147400 [Glycine max] Length = 113 Score = 90.9 bits (224), Expect = 2e-20 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 M SA+VED +FEDDQLANMT DDIVRASRLL+NEIRILKEELQRTNL LESYK Sbjct: 1 MVSAMVEDANFEDDQLANMTIDDIVRASRLLNNEIRILKEELQRTNLTLESYK 53 >XP_010039946.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Eucalyptus grandis] Length = 423 Score = 96.3 bits (238), Expect = 4e-20 Identities = 48/53 (90%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MA+A+VED++FEDDQLA+MTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 1 MATAMVEDSNFEDDQLASMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 53 >KCW45605.1 hypothetical protein EUGRSUZ_L00637 [Eucalyptus grandis] Length = 498 Score = 96.3 bits (238), Expect = 5e-20 Identities = 48/53 (90%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MA+A+VED++FEDDQLA+MTTDDIVRASRLLDNEIRILKEELQRTNLELESYK Sbjct: 76 MATAMVEDSNFEDDQLASMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 128 >XP_008778070.2 PREDICTED: 26S protease regulatory subunit 6A homolog [Phoenix dactylifera] Length = 111 Score = 89.4 bits (220), Expect = 6e-20 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA++ED SFEDDQLA+MTTDDI+RASRLLDNEIRILK+ELQRTNLELES+K Sbjct: 19 MASAMMED-SFEDDQLASMTTDDIIRASRLLDNEIRILKDELQRTNLELESFK 70 >XP_015875105.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Ziziphus jujuba] Length = 423 Score = 95.5 bits (236), Expect = 7e-20 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MASA+VEDTSFED+QLA+MT DDIVRASRLLDNEIRILKEELQRTNLEL+SYK Sbjct: 1 MASAMVEDTSFEDEQLASMTADDIVRASRLLDNEIRILKEELQRTNLELDSYK 53 >XP_019418866.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Lupinus angustifolius] OIV95096.1 hypothetical protein TanjilG_21486 [Lupinus angustifolius] Length = 423 Score = 95.1 bits (235), Expect = 9e-20 Identities = 47/53 (88%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MA+A+VED++FEDDQLA+MTTDDIVRASRLLDNEIRILKEELQRTNLEL+SYK Sbjct: 1 MATAMVEDSNFEDDQLASMTTDDIVRASRLLDNEIRILKEELQRTNLELDSYK 53 >XP_018841804.1 PREDICTED: 26S protease regulatory subunit 6A homolog [Juglans regia] Length = 423 Score = 95.1 bits (235), Expect = 9e-20 Identities = 47/53 (88%), Positives = 53/53 (100%) Frame = +3 Query: 384 MASAIVEDTSFEDDQLANMTTDDIVRASRLLDNEIRILKEELQRTNLELESYK 542 MA+A+VEDT+FEDDQLA+MTT+DIVRASRLLDNEIRILKEELQRTNLEL+SYK Sbjct: 1 MATAMVEDTTFEDDQLASMTTEDIVRASRLLDNEIRILKEELQRTNLELDSYK 53