BLASTX nr result
ID: Glycyrrhiza35_contig00020986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020986 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076863456.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 126 8e-35 WP_044537978.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 125 1e-34 WP_016841499.1 nucleotide exchange factor GrpE [Bradyrhizobium e... 125 2e-34 WP_074130019.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 124 3e-34 WP_024584259.1 MULTISPECIES: nucleotide exchange factor GrpE [Br... 124 3e-34 ERF82694.1 protein grpE [Bradyrhizobium sp. DFCI-1] 124 3e-34 WP_050404338.1 nucleotide exchange factor GrpE [Bradyrhizobium e... 124 5e-34 WP_038382701.1 nucleotide exchange factor GrpE [Bradyrhizobium e... 124 5e-34 WP_029081003.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 124 5e-34 WP_028341763.1 MULTISPECIES: nucleotide exchange factor GrpE [Br... 124 5e-34 WP_028335776.1 MULTISPECIES: nucleotide exchange factor GrpE [Br... 124 5e-34 WP_066514882.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 124 7e-34 WP_050628022.1 nucleotide exchange factor GrpE [Bradyrhizobium v... 124 7e-34 WP_044586401.1 nucleotide exchange factor GrpE [Bradyrhizobium s... 123 1e-33 SED59442.1 molecular chaperone GrpE [Bradyrhizobium erythrophlei] 123 1e-33 WP_056300399.1 nucleotide exchange factor GrpE [Afipia sp. Root1... 117 4e-31 OJY12977.1 nucleotide exchange factor GrpE [Rhizobiales bacteriu... 116 7e-31 WP_065754660.1 nucleotide exchange factor GrpE [Bradyrhizobium p... 115 1e-30 WP_057840976.1 nucleotide exchange factor GrpE [Bradyrhizobium j... 115 1e-30 SHL25818.1 molecular chaperone GrpE [Bradyrhizobium lablabi] 115 1e-30 >WP_076863456.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. SEMIA 6399] Length = 201 Score = 126 bits (316), Expect = 8e-35 Identities = 62/64 (96%), Positives = 62/64 (96%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 196 Query: 182 TDFT 193 DFT Sbjct: 197 ADFT 200 >WP_044537978.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. LTSP885] KJC47490.1 heat shock protein GrpE [Bradyrhizobium sp. LTSP885] Length = 201 Score = 125 bits (315), Expect = 1e-34 Identities = 61/65 (93%), Positives = 63/65 (96%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQV+QAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDVSVPSGTVVQVMQAGYMIGERILRPALVGVSKGGAKAAPA 196 Query: 182 TDFTA 196 DFTA Sbjct: 197 ADFTA 201 >WP_016841499.1 nucleotide exchange factor GrpE [Bradyrhizobium elkanii] ODM74316.1 nucleotide exchange factor GrpE [Bradyrhizobium elkanii] ODM82968.1 nucleotide exchange factor GrpE [Bradyrhizobium elkanii] OIM94383.1 nucleotide exchange factor GrpE [Bradyrhizobium elkanii] Length = 201 Score = 125 bits (314), Expect = 2e-34 Identities = 62/65 (95%), Positives = 62/65 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADITA 201 >WP_074130019.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. NAS96.2] OKO71940.1 heat shock protein GrpE [Bradyrhizobium sp. NAS96.2] Length = 201 Score = 124 bits (312), Expect = 3e-34 Identities = 61/64 (95%), Positives = 62/64 (96%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPA 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >WP_024584259.1 MULTISPECIES: nucleotide exchange factor GrpE [Bradyrhizobium] KIU50812.1 heat shock protein GrpE [Bradyrhizobium elkanii] OCX32825.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. UASWS1016] Length = 201 Score = 124 bits (312), Expect = 3e-34 Identities = 61/64 (95%), Positives = 62/64 (96%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAK+APS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKSAPS 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >ERF82694.1 protein grpE [Bradyrhizobium sp. DFCI-1] Length = 201 Score = 124 bits (312), Expect = 3e-34 Identities = 61/64 (95%), Positives = 62/64 (96%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIG+RILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGDRILRPALVGVSKGGAKAAPS 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >WP_050404338.1 nucleotide exchange factor GrpE [Bradyrhizobium embrapense] Length = 201 Score = 124 bits (311), Expect = 5e-34 Identities = 61/64 (95%), Positives = 61/64 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDTSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >WP_038382701.1 nucleotide exchange factor GrpE [Bradyrhizobium elkanii] Length = 201 Score = 124 bits (311), Expect = 5e-34 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPT 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADITA 201 >WP_029081003.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. th.b2] Length = 201 Score = 124 bits (311), Expect = 5e-34 Identities = 61/65 (93%), Positives = 61/65 (93%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAP Sbjct: 137 DPIGEKFDPNFQQAMFEVPDTSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPG 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADITA 201 >WP_028341763.1 MULTISPECIES: nucleotide exchange factor GrpE [Bradyrhizobium] KRP86729.1 molecular chaperone GrpE [Bradyrhizobium pachyrhizi] SDC85210.1 molecular chaperone GrpE [Bradyrhizobium sp. R5] OMI00626.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. UFLA 03-321] Length = 201 Score = 124 bits (311), Expect = 5e-34 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPT 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADITA 201 >WP_028335776.1 MULTISPECIES: nucleotide exchange factor GrpE [Bradyrhizobium] Length = 201 Score = 124 bits (311), Expect = 5e-34 Identities = 61/65 (93%), Positives = 62/65 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPT 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADITA 201 >WP_066514882.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. BR 10303] KWV45810.1 molecular chaperone GrpE [Bradyrhizobium sp. BR 10303] Length = 201 Score = 124 bits (310), Expect = 7e-34 Identities = 61/65 (93%), Positives = 61/65 (93%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKA P Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKATPV 196 Query: 182 TDFTA 196 DFTA Sbjct: 197 ADFTA 201 >WP_050628022.1 nucleotide exchange factor GrpE [Bradyrhizobium viridifuturi] Length = 201 Score = 124 bits (310), Expect = 7e-34 Identities = 61/64 (95%), Positives = 61/64 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDPSVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >WP_044586401.1 nucleotide exchange factor GrpE [Bradyrhizobium sp. LTSPM299] KJC61874.1 heat shock protein GrpE [Bradyrhizobium sp. LTSPM299] Length = 201 Score = 123 bits (309), Expect = 1e-33 Identities = 60/65 (92%), Positives = 62/65 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQV+QAGYMIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPIGEKFDPNFQQAMFEVPDVSVPSGTVVQVMQAGYMIGERILRPALVGVSKGGAKAAPA 196 Query: 182 TDFTA 196 D TA Sbjct: 197 ADLTA 201 >SED59442.1 molecular chaperone GrpE [Bradyrhizobium erythrophlei] Length = 201 Score = 123 bits (308), Expect = 1e-33 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DPIGEKFDPNFQQAMFEVPD SVPSGTVVQVVQAGYMIG+RILRPALVGVSKGGAKAAPS Sbjct: 137 DPIGEKFDPNFQQAMFEVPDTSVPSGTVVQVVQAGYMIGDRILRPALVGVSKGGAKAAPS 196 Query: 182 TDFT 193 D T Sbjct: 197 ADIT 200 >WP_056300399.1 nucleotide exchange factor GrpE [Afipia sp. Root123D2] KQW19416.1 molecular chaperone GrpE [Afipia sp. Root123D2] Length = 203 Score = 117 bits (292), Expect = 4e-31 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DP+GEKFDPN QQAMFE+PDASVP+GTVVQVVQAGYMIG+RILRPALVGVSKGGAKA PS Sbjct: 139 DPVGEKFDPNLQQAMFEIPDASVPAGTVVQVVQAGYMIGDRILRPALVGVSKGGAKAPPS 198 Query: 182 TDFT 193 D T Sbjct: 199 QDKT 202 >OJY12977.1 nucleotide exchange factor GrpE [Rhizobiales bacterium 62-47] Length = 198 Score = 116 bits (290), Expect = 7e-31 Identities = 56/62 (90%), Positives = 61/62 (98%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DP+GEKFDPNFQQAM+EVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAA + Sbjct: 137 DPMGEKFDPNFQQAMYEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAAA 196 Query: 182 TD 187 ++ Sbjct: 197 SE 198 >WP_065754660.1 nucleotide exchange factor GrpE [Bradyrhizobium paxllaeri] OCK62869.1 nucleotide exchange factor GrpE [Bradyrhizobium paxllaeri] Length = 201 Score = 115 bits (289), Expect = 1e-30 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DP GEKFDPNFQQAM+EVPD SVPSGTVVQVVQAG+MIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPSGEKFDPNFQQAMYEVPDPSVPSGTVVQVVQAGFMIGERILRPALVGVSKGGAKAAPA 196 Query: 182 TD 187 D Sbjct: 197 AD 198 >WP_057840976.1 nucleotide exchange factor GrpE [Bradyrhizobium jicamae] KRQ92652.1 molecular chaperone GrpE [Bradyrhizobium jicamae] Length = 201 Score = 115 bits (289), Expect = 1e-30 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DP GEKFDPNFQQAM+EVPD SVPSGTVVQVVQAG+MIGERILRPALVGVSKGGAKAAP+ Sbjct: 137 DPSGEKFDPNFQQAMYEVPDPSVPSGTVVQVVQAGFMIGERILRPALVGVSKGGAKAAPA 196 Query: 182 TD 187 D Sbjct: 197 AD 198 >SHL25818.1 molecular chaperone GrpE [Bradyrhizobium lablabi] Length = 203 Score = 115 bits (289), Expect = 1e-30 Identities = 55/61 (90%), Positives = 60/61 (98%) Frame = +2 Query: 2 DPIGEKFDPNFQQAMFEVPDASVPSGTVVQVVQAGYMIGERILRPALVGVSKGGAKAAPS 181 DP G+KFDPNFQQAM+EVPDASVP+GTVVQVVQAG+MIGER+LRPALVGVSKGGAKAAPS Sbjct: 137 DPSGQKFDPNFQQAMYEVPDASVPAGTVVQVVQAGFMIGERVLRPALVGVSKGGAKAAPS 196 Query: 182 T 184 T Sbjct: 197 T 197