BLASTX nr result
ID: Glycyrrhiza35_contig00020914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00020914 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076858483.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 69 9e-14 WP_074127234.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 69 9e-14 WP_024582400.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 69 1e-13 WP_050625628.1 hypothetical protein [Bradyrhizobium viridifuturi] 68 3e-13 ERF85160.1 glutamate-1-semialdehyde 2,1-aminomutase [Bradyrhizob... 68 3e-13 WP_016843366.1 hypothetical protein [Bradyrhizobium elkanii] ODM... 66 2e-12 WP_076831552.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-... 66 2e-12 WP_028335364.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 66 2e-12 WP_066510737.1 hypothetical protein [Bradyrhizobium sp. BR 10303... 65 6e-12 WP_038383204.1 hypothetical protein [Bradyrhizobium elkanii] 65 6e-12 WP_028342643.1 hypothetical protein [Bradyrhizobium elkanii] 65 6e-12 WP_044541359.1 hypothetical protein [Bradyrhizobium sp. LTSP885]... 65 6e-12 WP_057019631.1 hypothetical protein [Bradyrhizobium pachyrhizi] ... 64 8e-12 SEC37991.1 hypothetical protein SAMN05444164_1696 [Bradyrhizobiu... 64 2e-11 WP_051334948.1 hypothetical protein [Bradyrhizobium sp. Ai1a-2] 64 2e-11 WP_050402821.1 hypothetical protein [Bradyrhizobium embrapense] 63 3e-11 WP_051396658.1 hypothetical protein [Bradyrhizobium elkanii] 62 7e-11 WP_044585839.1 hypothetical protein [Bradyrhizobium sp. LTSPM299... 61 2e-10 WP_029080166.1 hypothetical protein [Bradyrhizobium sp. th.b2] 59 1e-09 WP_074814901.1 hypothetical protein [Bradyrhizobium lablabi] SDJ... 59 2e-09 >WP_076858483.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 83 Score = 69.3 bits (168), Expect = 9e-14 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREARQ 96 VLDNDYEIRPCQLEPNEDPV+NKADADREARQ Sbjct: 47 VLDNDYEIRPCQLEPNEDPVKNKADADREARQ 78 >WP_074127234.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO78732.1 hypothetical protein AC628_12845 [Bradyrhizobium sp. NAS96.2] Length = 83 Score = 69.3 bits (168), Expect = 9e-14 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREARQ 96 VLDNDYEIRPCQLEPNEDPV+NKADADREARQ Sbjct: 47 VLDNDYEIRPCQLEPNEDPVKNKADADREARQ 78 >WP_024582400.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU43378.1 hypothetical protein QU41_35485 [Bradyrhizobium elkanii] OCX28601.1 hypothetical protein QU42_21295 [Bradyrhizobium sp. UASWS1016] Length = 83 Score = 68.9 bits (167), Expect = 1e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREARQ 96 VLDN+YEIRPCQLEPNEDPVQNKADADREARQ Sbjct: 47 VLDNNYEIRPCQLEPNEDPVQNKADADREARQ 78 >WP_050625628.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 83 Score = 68.2 bits (165), Expect = 3e-13 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREARQ 96 VLDNDYEIRPCQL+PNEDPV+NKADADREARQ Sbjct: 47 VLDNDYEIRPCQLDPNEDPVKNKADADREARQ 78 >ERF85160.1 glutamate-1-semialdehyde 2,1-aminomutase [Bradyrhizobium sp. DFCI-1] Length = 83 Score = 68.2 bits (165), Expect = 3e-13 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREARQ 96 VLDNDYEIRPCQL+PNEDPV+NKADADREARQ Sbjct: 47 VLDNDYEIRPCQLDPNEDPVKNKADADREARQ 78 >WP_016843366.1 hypothetical protein [Bradyrhizobium elkanii] ODM75358.1 hypothetical protein A6452_37750 [Bradyrhizobium elkanii] ODM85825.1 hypothetical protein A6X20_11490 [Bradyrhizobium elkanii] SDD15657.1 hypothetical protein SAMN05216337_100884 [Bradyrhizobium sp. R5] OIM89048.1 hypothetical protein BLN97_41690 [Bradyrhizobium elkanii] Length = 82 Score = 65.9 bits (159), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQLEPNEDP +NKADADREAR Sbjct: 46 VLDNDYEIRPCQLEPNEDPAKNKADADREAR 76 >WP_076831552.1 hypothetical protein [Bradyrhizobium sp. UFLA 03-321] OMI03843.1 hypothetical protein BSN85_28200 [Bradyrhizobium sp. UFLA 03-321] Length = 83 Score = 65.9 bits (159), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQLEPNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCQLEPNEDPAKNKADADREAR 77 >WP_028335364.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 83 Score = 65.9 bits (159), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQLEPNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCQLEPNEDPAKNKADADREAR 77 >WP_066510737.1 hypothetical protein [Bradyrhizobium sp. BR 10303] KWV51395.1 hypothetical protein AS156_12475 [Bradyrhizobium sp. BR 10303] Length = 83 Score = 64.7 bits (156), Expect = 6e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 +LDNDYEIRPCQL+PNEDP QNKADADREAR Sbjct: 47 ILDNDYEIRPCQLDPNEDPDQNKADADREAR 77 >WP_038383204.1 hypothetical protein [Bradyrhizobium elkanii] Length = 83 Score = 64.7 bits (156), Expect = 6e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQL+PNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCQLDPNEDPAKNKADADREAR 77 >WP_028342643.1 hypothetical protein [Bradyrhizobium elkanii] Length = 83 Score = 64.7 bits (156), Expect = 6e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQL+PNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCQLDPNEDPAKNKADADREAR 77 >WP_044541359.1 hypothetical protein [Bradyrhizobium sp. LTSP885] KJC38083.1 hypothetical protein UP09_26970 [Bradyrhizobium sp. LTSP885] Length = 84 Score = 64.7 bits (156), Expect = 6e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQL+PNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCQLDPNEDPARNKADADREAR 77 >WP_057019631.1 hypothetical protein [Bradyrhizobium pachyrhizi] KRP88170.1 hypothetical protein AOQ73_29745 [Bradyrhizobium pachyrhizi] Length = 83 Score = 64.3 bits (155), Expect = 8e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPC+LEPNEDP +NKADADREAR Sbjct: 47 VLDNDYEIRPCRLEPNEDPAKNKADADREAR 77 >SEC37991.1 hypothetical protein SAMN05444164_1696 [Bradyrhizobium erythrophlei] Length = 83 Score = 63.5 bits (153), Expect = 2e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQ EPNEDPV+NKADADR+AR Sbjct: 47 VLDNDYEIRPCQPEPNEDPVKNKADADRDAR 77 >WP_051334948.1 hypothetical protein [Bradyrhizobium sp. Ai1a-2] Length = 100 Score = 63.9 bits (154), Expect = 2e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQ EPNEDPV+NKADA+REAR Sbjct: 47 VLDNDYEIRPCQAEPNEDPVKNKADAEREAR 77 >WP_050402821.1 hypothetical protein [Bradyrhizobium embrapense] Length = 83 Score = 62.8 bits (151), Expect = 3e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREA 90 VLDNDYEIRPCQ EPNEDPV+NKADADREA Sbjct: 47 VLDNDYEIRPCQPEPNEDPVKNKADADREA 76 >WP_051396658.1 hypothetical protein [Bradyrhizobium elkanii] Length = 99 Score = 62.4 bits (150), Expect = 7e-11 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQ EPNEDP +NKADA+REAR Sbjct: 47 VLDNDYEIRPCQAEPNEDPAKNKADAEREAR 77 >WP_044585839.1 hypothetical protein [Bradyrhizobium sp. LTSPM299] KJC62262.1 hypothetical protein UP10_02685 [Bradyrhizobium sp. LTSPM299] Length = 84 Score = 60.8 bits (146), Expect = 2e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQL+PNEDP +NKADAD +AR Sbjct: 47 VLDNDYEIRPCQLDPNEDPARNKADADLQAR 77 >WP_029080166.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 83 Score = 58.9 bits (141), Expect = 1e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 +L+N+YEIRPCQ EP+EDPV+NKADADREAR Sbjct: 47 LLENNYEIRPCQAEPDEDPVKNKADADREAR 77 >WP_074814901.1 hypothetical protein [Bradyrhizobium lablabi] SDJ91563.1 hypothetical protein SAMN05444163_6745 [Bradyrhizobium ottawaense] SEB99470.1 hypothetical protein SAMN05444171_0412 [Bradyrhizobium lablabi] SHM67281.1 hypothetical protein SAMN05444321_7191 [Bradyrhizobium lablabi] Length = 84 Score = 58.5 bits (140), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 VLDNDYEIRPCQLEPNEDPVQNKADADREAR 93 VLDNDYEIRPCQ EP+EDP +NKADA+R+AR Sbjct: 47 VLDNDYEIRPCQPEPHEDPAKNKADAERDAR 77